Anti CREB1 pAb (ATL-HPA019150)

Atlas Antibodies

Catalog No.:
ATL-HPA019150-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: cAMP responsive element binding protein 1
Gene Name: CREB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025958: 100%, ENSRNOG00000013412: 100%
Entrez Gene ID: 1385
Uniprot ID: P16220
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
Gene Sequence STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
Gene ID - Mouse ENSMUSG00000025958
Gene ID - Rat ENSRNOG00000013412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CREB1 pAb (ATL-HPA019150)
Datasheet Anti CREB1 pAb (ATL-HPA019150) Datasheet (External Link)
Vendor Page Anti CREB1 pAb (ATL-HPA019150) at Atlas Antibodies

Documents & Links for Anti CREB1 pAb (ATL-HPA019150)
Datasheet Anti CREB1 pAb (ATL-HPA019150) Datasheet (External Link)
Vendor Page Anti CREB1 pAb (ATL-HPA019150)