Anti CREB1 pAb (ATL-HPA019150)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019150-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CREB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025958: 100%, ENSRNOG00000013412: 100%
Entrez Gene ID: 1385
Uniprot ID: P16220
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG |
| Gene Sequence | STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG |
| Gene ID - Mouse | ENSMUSG00000025958 |
| Gene ID - Rat | ENSRNOG00000013412 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CREB1 pAb (ATL-HPA019150) | |
| Datasheet | Anti CREB1 pAb (ATL-HPA019150) Datasheet (External Link) |
| Vendor Page | Anti CREB1 pAb (ATL-HPA019150) at Atlas Antibodies |
| Documents & Links for Anti CREB1 pAb (ATL-HPA019150) | |
| Datasheet | Anti CREB1 pAb (ATL-HPA019150) Datasheet (External Link) |
| Vendor Page | Anti CREB1 pAb (ATL-HPA019150) |