Anti CREB1 pAb (ATL-HPA019150)

Atlas Antibodies

SKU: ATL-HPA019150-25

• 
• 
• 

Protein Description: cAMP responsive element binding protein 1
Gene Name: CREB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025958: 100%, ENSRNOG00000013412: 100%
Entrez Gene ID: 1385
Uniprot ID: P16220
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
• Gene Sequence: STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
• Gene ID - Mouse: ENSMUSG00000025958
• Gene ID - Rat: ENSRNOG00000013412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.