Anti CRCP pAb (ATL-HPA007216)

Atlas Antibodies

SKU: ATL-HPA007216-25

• 
• 
• 

Protein Description: CGRP receptor component
Gene Name: CRCP
Alternative Gene Name: CGRP-RCP, RCP, RCP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025532: 85%, ENSRNOG00000000901: 83%
Entrez Gene ID: 27297
Uniprot ID: O75575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
• Gene Sequence: TPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
• Gene ID - Mouse: ENSMUSG00000025532
• Gene ID - Rat: ENSRNOG00000000901
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.