Anti CRCP pAb (ATL-HPA007216)

Atlas Antibodies

Catalog No.:
ATL-HPA007216-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CGRP receptor component
Gene Name: CRCP
Alternative Gene Name: CGRP-RCP, RCP, RCP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025532: 85%, ENSRNOG00000000901: 83%
Entrez Gene ID: 27297
Uniprot ID: O75575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Gene Sequence TPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Gene ID - Mouse ENSMUSG00000025532
Gene ID - Rat ENSRNOG00000000901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRCP pAb (ATL-HPA007216)
Datasheet Anti CRCP pAb (ATL-HPA007216) Datasheet (External Link)
Vendor Page Anti CRCP pAb (ATL-HPA007216) at Atlas Antibodies

Documents & Links for Anti CRCP pAb (ATL-HPA007216)
Datasheet Anti CRCP pAb (ATL-HPA007216) Datasheet (External Link)
Vendor Page Anti CRCP pAb (ATL-HPA007216)