Anti CRCP pAb (ATL-HPA007216)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007216-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CRCP
Alternative Gene Name: CGRP-RCP, RCP, RCP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025532: 85%, ENSRNOG00000000901: 83%
Entrez Gene ID: 27297
Uniprot ID: O75575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA |
| Gene Sequence | TPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA |
| Gene ID - Mouse | ENSMUSG00000025532 |
| Gene ID - Rat | ENSRNOG00000000901 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRCP pAb (ATL-HPA007216) | |
| Datasheet | Anti CRCP pAb (ATL-HPA007216) Datasheet (External Link) |
| Vendor Page | Anti CRCP pAb (ATL-HPA007216) at Atlas Antibodies |
| Documents & Links for Anti CRCP pAb (ATL-HPA007216) | |
| Datasheet | Anti CRCP pAb (ATL-HPA007216) Datasheet (External Link) |
| Vendor Page | Anti CRCP pAb (ATL-HPA007216) |