Anti CRBN pAb (ATL-HPA045910 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045910-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cereblon
Gene Name: CRBN
Alternative Gene Name: MRT2, MRT2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005362: 96%, ENSRNOG00000006534: 97%
Entrez Gene ID: 51185
Uniprot ID: Q96SW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE
Gene Sequence EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE
Gene ID - Mouse ENSMUSG00000005362
Gene ID - Rat ENSRNOG00000006534
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRBN pAb (ATL-HPA045910 w/enhanced validation)
Datasheet Anti CRBN pAb (ATL-HPA045910 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRBN pAb (ATL-HPA045910 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CRBN pAb (ATL-HPA045910 w/enhanced validation)
Datasheet Anti CRBN pAb (ATL-HPA045910 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRBN pAb (ATL-HPA045910 w/enhanced validation)
Citations for Anti CRBN pAb (ATL-HPA045910 w/enhanced validation) – 21 Found
Del Prete, Dolores; Rice, Richard C; Rajadhyaksha, Anjali M; D'Adamio, Luciano. Amyloid Precursor Protein (APP) May Act as a Substrate and a Recognition Unit for CRL4CRBN and Stub1 E3 Ligases Facilitating Ubiquitination of Proteins Involved in Presynaptic Functions and Neurodegeneration. The Journal Of Biological Chemistry. 2016;291(33):17209-27.  PubMed
Millrine, David; Tei, Mami; Gemechu, Yohannes; Kishimoto, Tadamitsu. Rabex-5 is a lenalidomide target molecule that negatively regulates TLR-induced type 1 IFN production. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(38):10625-30.  PubMed
Nguyen, Thang Van; Li, Jing; Lu, Chin-Chun Jean; Mamrosh, Jennifer L; Lu, Gang; Cathers, Brian E; Deshaies, Raymond J. p97/VCP promotes degradation of CRBN substrate glutamine synthetase and neosubstrates. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(14):3565-3571.  PubMed
Zhu, Yuan Xiao; Shi, Chang-Xin; Bruins, Laura A; Wang, Xuewei; Riggs, Daniel L; Porter, Brooke; Ahmann, Jonathan M; de Campos, Cecilia Bonolo; Braggio, Esteban; Bergsagel, P Leif; Stewart, A Keith. Identification of lenalidomide resistance pathways in myeloma and targeted resensitization using cereblon replacement, inhibition of STAT3 or targeting of IRF4. Blood Cancer Journal. 2019;9(2):19.  PubMed
Zhou, Nan; Gutierrez-Uzquiza, Alvaro; Zheng, Xiang Yu; Chang, Renxu; Vogl, Dan T; Garfall, Alfred L; Bernabei, Luca; Saraf, Anita; Florens, Laurence; Washburn, Michael P; Illendula, Anuradha; Bushweller, John H; Busino, Luca. RUNX proteins desensitize multiple myeloma to lenalidomide via protecting IKZFs from degradation. Leukemia. 2019;33(8):2006-2021.  PubMed
Abruzzese, Maria Pia; Bilotta, Maria Teresa; Fionda, Cinzia; Zingoni, Alessandra; Soriani, Alessandra; Petrucci, Maria Teresa; Ricciardi, Maria Rosaria; Molfetta, Rosa; Paolini, Rossella; Santoni, Angela; Cippitelli, Marco. The homeobox transcription factor MEIS2 is a regulator of cancer cell survival and IMiDs activity in Multiple Myeloma: modulation by Bromodomain and Extra-Terminal (BET) protein inhibitors. Cell Death & Disease. 2019;10(4):324.  PubMed
Park, Seulki; Kim, Kidae; Haam, Keeok; Ban, Hyun Seung; Kim, Jung-Ae; Park, Byoung Chul; Park, Sung Goo; Kim, Sunhong; Kim, Jeong-Hoon. Long-term depletion of cereblon induces mitochondrial dysfunction in cancer cells. Bmb Reports. 2021;54(6):305-310.  PubMed
Akber, Uroos; Jo, Heeji; Jeon, Seungje; Yang, Seung-Joo; Bong, Sunhwa; Lim, Sungsu; Kim, Yun Kyung; Park, Zee-Yong; Park, Chul-Seung. Cereblon Regulates the Proteotoxicity of Tau by Tuning the Chaperone Activity of DNAJA1. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2021;41(24):5138-5156.  PubMed
Petillo, Sara; Capuano, Cristina; Molfetta, Rosa; Fionda, Cinzia; Mekhloufi, Abdelilah; Pighi, Chiara; Antonangeli, Fabrizio; Zingoni, Alessandra; Soriani, Alessandra; Petrucci, Maria Teresa; Galandrini, Ricciarda; Paolini, Rossella; Santoni, Angela; Cippitelli, Marco. Immunomodulatory effect of NEDD8-activating enzyme inhibition in Multiple Myeloma: upregulation of NKG2D ligands and sensitization to Natural Killer cell recognition. Cell Death & Disease. 2021;12(9):836.  PubMed
Liao, Xinmei; Qian, Xiaoqing; Zhang, Zimu; Tao, Yanfang; Li, Zhiheng; Zhang, Qian; Liang, Hui; Li, Xiaolu; Xie, Yi; Zhuo, Ran; Chen, Yanling; Jiang, You; Cao, Haibo; Niu, Jiaqi; Xue, Cuili; Ni, Jian; Pan, Jian; Cui, Daxiang. ARV-825 Demonstrates Antitumor Activity in Gastric Cancer via MYC-Targets and G2M-Checkpoint Signaling Pathways. Frontiers In Oncology. 11( 34733788):753119.  PubMed
Zhang, Kunlong; Gao, Li; Wang, Jianwei; Chu, Xinran; Zhang, Zimu; Zhang, Yongping; Fang, Fang; Tao, Yanfang; Li, Xiaolu; Tian, Yuanyuan; Li, Zhiheng; Sang, Xu; Ma, Li; Lu, Lihui; Chen, Yanling; Yu, Juanjuan; Zhuo, Ran; Wu, Shuiyan; Pan, Jian; Hu, Shaoyan. A Novel BRD Family PROTAC Inhibitor dBET1 Exerts Great Anti-Cancer Effects by Targeting c-MYC in Acute Myeloid Leukemia Cells. Pathology Oncology Research : Por. 28( 35832114):1610447.  PubMed
Gandhi, Anita K; Mendy, Derek; Waldman, Michelle; Chen, Gengxin; Rychak, Emily; Miller, Karen; Gaidarova, Svetlana; Ren, Yan; Wang, Maria; Breider, Michael; Carmel, Gilles; Mahmoudi, Afshin; Jackson, Pilgrim; Abbasian, Mahan; Cathers, Brian E; Schafer, Peter H; Daniel, Tom O; Lopez-Girona, Antonia; Thakurta, Anjan; Chopra, Rajesh. Measuring cereblon as a biomarker of response or resistance to lenalidomide and pomalidomide requires use of standardized reagents and understanding of gene complexity. British Journal Of Haematology. 2014;164(2):233-44.  PubMed
Dimopoulos, Konstantinos; Søgaard Helbo, Alexandra; Fibiger Munch-Petersen, Helga; Sjö, Lene; Christensen, Jesper; Sommer Kristensen, Lasse; Asmar, Fazila; Hermansen, Niels Emil Ulrich; O'Connel, Casey; Gimsing, Peter; Liang, Gangning; Grønbaek, Kirsten. Dual inhibition of DNMTs and EZH2 can overcome both intrinsic and acquired resistance of myeloma cells to IMiDs in a cereblon-independent manner. Molecular Oncology. 2018;12(2):180-195.  PubMed
Kim, Kidae; Lee, Dong Ho; Park, Sungryul; Jo, Seung-Hyun; Ku, Bonsu; Park, Sung Goo; Park, Byoung Chul; Jeon, Yeong Uk; Ahn, Sunjoo; Kang, Chung Hyo; Hwang, Daehee; Chae, Sehyun; Ha, Jae Du; Kim, Sunhong; Hwang, Jong Yeon; Kim, Jeong-Hoon. Disordered region of cereblon is required for efficient degradation by proteolysis-targeting chimera. Scientific Reports. 2019;9(1):19654.  PubMed
Słabicki, Mikołaj; Kozicka, Zuzanna; Petzold, Georg; Li, Yen-Der; Manojkumar, Manisha; Bunker, Richard D; Donovan, Katherine A; Sievers, Quinlan L; Koeppel, Jonas; Suchyta, Dakota; Sperling, Adam S; Fink, Emma C; Gasser, Jessica A; Wang, Li R; Corsello, Steven M; Sellar, Rob S; Jan, Max; Gillingham, Dennis; Scholl, Claudia; Fröhling, Stefan; Golub, Todd R; Fischer, Eric S; Thomä, Nicolas H; Ebert, Benjamin L. The CDK inhibitor CR8 acts as a molecular glue degrader that depletes cyclin K. Nature. 2020;585(7824):293-297.  PubMed
Moon, Hyunji; Min, Chanhyuk; Kim, Gayoung; Kim, Deokhwan; Kim, Kwanhyeong; Lee, Sang-Ah; Moon, Byeongjin; Yang, Susumin; Lee, Juyeon; Yang, Seung-Joo; Cho, Steve K; Lee, Gwangrog; Lee, Chang Sup; Park, Chul-Seung; Park, Daeho. Crbn modulates calcium influx by regulating Orai1 during efferocytosis. Nature Communications. 2020;11(1):5489.  PubMed
Li, Zhiheng; Lim, Su Lin; Tao, Yanfang; Li, Xiaolu; Xie, Yi; Yang, Chun; Zhang, Zimu; Jiang, You; Zhang, Xianbing; Cao, Xu; Wang, Hairong; Qian, Guanghui; Wu, Yi; Li, Mei; Fang, Fang; Liu, Ying; Fu, Mingcui; Ding, Xin; Zhu, Zhenghong; Lv, Haitao; Lu, Jun; Xiao, Sheng; Hu, Shaoyan; Pan, Jian. PROTAC Bromodomain Inhibitor ARV-825 Displays Anti-Tumor Activity in Neuroblastoma by Repressing Expression of MYCN or c-Myc. Frontiers In Oncology. 10( 33324552):574525.  PubMed
Shrestha, Prabha; Davis, David A; Jaeger, Hannah K; Stream, Alexandra; Aisabor, Ashley I; Yarchoan, Robert. Pomalidomide restores immune recognition of primary effusion lymphoma through upregulation of ICAM-1 and B7-2. Plos Pathogens. 2021;17(1):e1009091.  PubMed
Wu, Shuiyan; Jiang, You; Hong, Yi; Chu, Xinran; Zhang, Zimu; Tao, Yanfang; Fan, Ziwei; Bai, Zhenjiang; Li, Xiaolu; Chen, Yanling; Li, Zhiheng; Ding, Xin; Lv, Haitao; Du, Xiaoli; Lim, Su Lin; Zhang, Yongping; Huang, Saihu; Lu, Jun; Pan, Jian; Hu, Shaoyan. BRD4 PROTAC degrader ARV-825 inhibits T-cell acute lymphoblastic leukemia by targeting 'Undruggable' Myc-pathway genes. Cancer Cell International. 2021;21(1):230.  PubMed
Luo, Xin; Archibeque, Ivonne; Dellamaggiore, Ken; Smither, Kate; Homann, Oliver; Lipford, James Russell; Mohl, Dane. Profiling of diverse tumor types establishes the broad utility of VHL-based ProTaCs and triages candidate ubiquitin ligases. Iscience. 2022;25(3):103985.  PubMed
Yang, Seung-Joo; Jeon, Seungje; Baek, Jeong Won; Lee, Kwang Min; Park, Chul-Seung. Regulation of AMPK Activity by CRBN Is Independent of the Thalidomide-CRL4(CRBN) Protein Degradation Axis. Pharmaceuticals (Basel, Switzerland). 2021;14(6)  PubMed