Anti CRB2 pAb (ATL-HPA043674)

Atlas Antibodies

SKU:
ATL-HPA043674-25
  • Immunohistochemical staining of human Eye, retina shows strong positivity in outer limiting membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: crumbs family member 2
Gene Name: CRB2
Alternative Gene Name: FLJ16786, FLJ38464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035403: 72%, ENSRNOG00000025498: 75%
Entrez Gene ID: 286204
Uniprot ID: Q5IJ48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RWDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFFPLPLDNSSQPSELGGRQSWNLT
Gene Sequence RWDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFFPLPLDNSSQPSELGGRQSWNLT
Gene ID - Mouse ENSMUSG00000035403
Gene ID - Rat ENSRNOG00000025498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CRB2 pAb (ATL-HPA043674)
Datasheet Anti CRB2 pAb (ATL-HPA043674) Datasheet (External Link)
Vendor Page Anti CRB2 pAb (ATL-HPA043674) at Atlas Antibodies

Documents & Links for Anti CRB2 pAb (ATL-HPA043674)
Datasheet Anti CRB2 pAb (ATL-HPA043674) Datasheet (External Link)
Vendor Page Anti CRB2 pAb (ATL-HPA043674)