Anti CRB2 pAb (ATL-HPA043674)

Atlas Antibodies

Catalog No.: ATL-HPA043674-25

Protein Description: crumbs family member 2
Gene Name: CRB2
Alternative Gene Name: FLJ16786, FLJ38464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035403: 72%, ENSRNOG00000025498: 75%
Entrez Gene ID: 286204
Uniprot ID: Q5IJ48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RWDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFFPLPLDNSSQPSELGGRQSWNLT
• Gene Sequence: RWDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFFPLPLDNSSQPSELGGRQSWNLT
• Gene ID - Mouse: ENSMUSG00000035403
• Gene ID - Rat: ENSRNOG00000025498
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.