Anti CRB2 pAb (ATL-HPA043674)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043674-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CRB2
Alternative Gene Name: FLJ16786, FLJ38464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035403: 72%, ENSRNOG00000025498: 75%
Entrez Gene ID: 286204
Uniprot ID: Q5IJ48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RWDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFFPLPLDNSSQPSELGGRQSWNLT |
| Gene Sequence | RWDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFFPLPLDNSSQPSELGGRQSWNLT |
| Gene ID - Mouse | ENSMUSG00000035403 |
| Gene ID - Rat | ENSRNOG00000025498 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRB2 pAb (ATL-HPA043674) | |
| Datasheet | Anti CRB2 pAb (ATL-HPA043674) Datasheet (External Link) |
| Vendor Page | Anti CRB2 pAb (ATL-HPA043674) at Atlas Antibodies |
| Documents & Links for Anti CRB2 pAb (ATL-HPA043674) | |
| Datasheet | Anti CRB2 pAb (ATL-HPA043674) Datasheet (External Link) |
| Vendor Page | Anti CRB2 pAb (ATL-HPA043674) |