Anti CRB1 pAb (ATL-HPA063127)

Atlas Antibodies

Catalog No.:
ATL-HPA063127-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: crumbs family member 1, photoreceptor morphogenesis associated
Gene Name: CRB1
Alternative Gene Name: LCA8, RP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063681: 75%, ENSRNOG00000010903: 73%
Entrez Gene ID: 23418
Uniprot ID: P82279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NHITLENISSGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDDSTGYVIFTLDESYGDTISLSMFVRTL
Gene Sequence NHITLENISSGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDDSTGYVIFTLDESYGDTISLSMFVRTL
Gene ID - Mouse ENSMUSG00000063681
Gene ID - Rat ENSRNOG00000010903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRB1 pAb (ATL-HPA063127)
Datasheet Anti CRB1 pAb (ATL-HPA063127) Datasheet (External Link)
Vendor Page Anti CRB1 pAb (ATL-HPA063127) at Atlas Antibodies

Documents & Links for Anti CRB1 pAb (ATL-HPA063127)
Datasheet Anti CRB1 pAb (ATL-HPA063127) Datasheet (External Link)
Vendor Page Anti CRB1 pAb (ATL-HPA063127)