Anti CRB1 pAb (ATL-HPA063127)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063127-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CRB1
Alternative Gene Name: LCA8, RP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063681: 75%, ENSRNOG00000010903: 73%
Entrez Gene ID: 23418
Uniprot ID: P82279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NHITLENISSGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDDSTGYVIFTLDESYGDTISLSMFVRTL |
Gene Sequence | NHITLENISSGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDDSTGYVIFTLDESYGDTISLSMFVRTL |
Gene ID - Mouse | ENSMUSG00000063681 |
Gene ID - Rat | ENSRNOG00000010903 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRB1 pAb (ATL-HPA063127) | |
Datasheet | Anti CRB1 pAb (ATL-HPA063127) Datasheet (External Link) |
Vendor Page | Anti CRB1 pAb (ATL-HPA063127) at Atlas Antibodies |
Documents & Links for Anti CRB1 pAb (ATL-HPA063127) | |
Datasheet | Anti CRB1 pAb (ATL-HPA063127) Datasheet (External Link) |
Vendor Page | Anti CRB1 pAb (ATL-HPA063127) |