Anti CRAT pAb (ATL-HPA022815 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA022815-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: carnitine O-acetyltransferase
Gene Name: CRAT
Alternative Gene Name: CAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026853: 91%, ENSRNOG00000018145: 91%
Entrez Gene ID: 1384
Uniprot ID: P43155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIK
Gene Sequence YQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIK
Gene ID - Mouse ENSMUSG00000026853
Gene ID - Rat ENSRNOG00000018145
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRAT pAb (ATL-HPA022815 w/enhanced validation)
Datasheet Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CRAT pAb (ATL-HPA022815 w/enhanced validation)
Datasheet Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRAT pAb (ATL-HPA022815 w/enhanced validation)
Citations for Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) – 3 Found
Berg, Sofia Mikkelsen; Beck-Nielsen, Henning; Færgeman, Nils Joakim; Gaster, Michael. Carnitine acetyltransferase: A new player in skeletal muscle insulin resistance?. Biochemistry And Biophysics Reports. 2017;9( 28955988):47-50.  PubMed
Ryu, Jae Yong; Kim, Hyun Uk; Lee, Sang Yup. Framework and resource for more than 11,000 gene-transcript-protein-reaction associations in human metabolism. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(45):E9740-E9749.  PubMed
Drecourt, Anthony; Babdor, Joël; Dussiot, Michael; Petit, Floriane; Goudin, Nicolas; Garfa-Traoré, Meriem; Habarou, Florence; Bole-Feysot, Christine; Nitschké, Patrick; Ottolenghi, Chris; Metodiev, Metodi D; Serre, Valérie; Desguerre, Isabelle; Boddaert, Nathalie; Hermine, Olivier; Munnich, Arnold; Rötig, Agnès. Impaired Transferrin Receptor Palmitoylation and Recycling in Neurodegeneration with Brain Iron Accumulation. American Journal Of Human Genetics. 2018;102(2):266-277.  PubMed