Anti CRAT pAb (ATL-HPA022815 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022815-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CRAT
Alternative Gene Name: CAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026853: 91%, ENSRNOG00000018145: 91%
Entrez Gene ID: 1384
Uniprot ID: P43155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIK |
| Gene Sequence | YQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIK |
| Gene ID - Mouse | ENSMUSG00000026853 |
| Gene ID - Rat | ENSRNOG00000018145 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) | |
| Datasheet | Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) | |
| Datasheet | Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) |
| Citations for Anti CRAT pAb (ATL-HPA022815 w/enhanced validation) – 3 Found |
| Berg, Sofia Mikkelsen; Beck-Nielsen, Henning; Færgeman, Nils Joakim; Gaster, Michael. Carnitine acetyltransferase: A new player in skeletal muscle insulin resistance?. Biochemistry And Biophysics Reports. 2017;9( 28955988):47-50. PubMed |
| Ryu, Jae Yong; Kim, Hyun Uk; Lee, Sang Yup. Framework and resource for more than 11,000 gene-transcript-protein-reaction associations in human metabolism. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(45):E9740-E9749. PubMed |
| Drecourt, Anthony; Babdor, Joël; Dussiot, Michael; Petit, Floriane; Goudin, Nicolas; Garfa-Traoré, Meriem; Habarou, Florence; Bole-Feysot, Christine; Nitschké, Patrick; Ottolenghi, Chris; Metodiev, Metodi D; Serre, Valérie; Desguerre, Isabelle; Boddaert, Nathalie; Hermine, Olivier; Munnich, Arnold; Rötig, Agnès. Impaired Transferrin Receptor Palmitoylation and Recycling in Neurodegeneration with Brain Iron Accumulation. American Journal Of Human Genetics. 2018;102(2):266-277. PubMed |