Anti CRAT pAb (ATL-HPA019230 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019230-25
  • Immunohistochemistry analysis in human testis and lymph node tissues using HPA019230 antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-CRAT antibody HPA019230 (A) shows similar pattern to independent antibody HPA020260 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: carnitine O-acetyltransferase
Gene Name: CRAT
Alternative Gene Name: CAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026853: 90%, ENSRNOG00000018145: 90%
Entrez Gene ID: 1384
Uniprot ID: P43155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF
Gene Sequence RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDF
Gene ID - Mouse ENSMUSG00000026853
Gene ID - Rat ENSRNOG00000018145
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CRAT pAb (ATL-HPA019230 w/enhanced validation)
Datasheet Anti CRAT pAb (ATL-HPA019230 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRAT pAb (ATL-HPA019230 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CRAT pAb (ATL-HPA019230 w/enhanced validation)
Datasheet Anti CRAT pAb (ATL-HPA019230 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRAT pAb (ATL-HPA019230 w/enhanced validation)



Citations for Anti CRAT pAb (ATL-HPA019230 w/enhanced validation) – 1 Found
Sun, Chenglong; Wang, Fukai; Zhang, Yang; Yu, Jinqian; Wang, Xiao. Mass spectrometry imaging-based metabolomics to visualize the spatially resolved reprogramming of carnitine metabolism in breast cancer. Theranostics. 10(16):7070-7082.  PubMed