Anti CRAMP1 pAb (ATL-HPA041752)
Atlas Antibodies
- SKU:
- ATL-HPA041752-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CRAMP1
Alternative Gene Name: CRAMP1L, KIAA1426
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038002: 93%, ENSRNOG00000024635: 93%
Entrez Gene ID: 57585
Uniprot ID: Q96RY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSENQSHN |
Gene Sequence | LRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSENQSHN |
Gene ID - Mouse | ENSMUSG00000038002 |
Gene ID - Rat | ENSRNOG00000024635 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CRAMP1 pAb (ATL-HPA041752) | |
Datasheet | Anti CRAMP1 pAb (ATL-HPA041752) Datasheet (External Link) |
Vendor Page | Anti CRAMP1 pAb (ATL-HPA041752) at Atlas Antibodies |
Documents & Links for Anti CRAMP1 pAb (ATL-HPA041752) | |
Datasheet | Anti CRAMP1 pAb (ATL-HPA041752) Datasheet (External Link) |
Vendor Page | Anti CRAMP1 pAb (ATL-HPA041752) |