Anti CRAMP1 pAb (ATL-HPA041752)

Atlas Antibodies

SKU:
ATL-HPA041752-25
  • Immunohistochemical staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cramped chromatin regulator homolog 1
Gene Name: CRAMP1
Alternative Gene Name: CRAMP1L, KIAA1426
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038002: 93%, ENSRNOG00000024635: 93%
Entrez Gene ID: 57585
Uniprot ID: Q96RY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSENQSHN
Gene Sequence LRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSENQSHN
Gene ID - Mouse ENSMUSG00000038002
Gene ID - Rat ENSRNOG00000024635
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CRAMP1 pAb (ATL-HPA041752)
Datasheet Anti CRAMP1 pAb (ATL-HPA041752) Datasheet (External Link)
Vendor Page Anti CRAMP1 pAb (ATL-HPA041752) at Atlas Antibodies

Documents & Links for Anti CRAMP1 pAb (ATL-HPA041752)
Datasheet Anti CRAMP1 pAb (ATL-HPA041752) Datasheet (External Link)
Vendor Page Anti CRAMP1 pAb (ATL-HPA041752)