Anti CRAMP1 pAb (ATL-HPA041752)

Atlas Antibodies

Catalog No.: ATL-HPA041752-25

Protein Description: cramped chromatin regulator homolog 1
Gene Name: CRAMP1
Alternative Gene Name: CRAMP1L, KIAA1426
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038002: 93%, ENSRNOG00000024635: 93%
Entrez Gene ID: 57585
Uniprot ID: Q96RY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSENQSHN
• Gene Sequence: LRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSENQSHN
• Gene ID - Mouse: ENSMUSG00000038002
• Gene ID - Rat: ENSRNOG00000024635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.