Anti CRACR2B pAb (ATL-HPA046217 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA046217-25

Protein Description: calcium release activated channel regulator 2B
Gene Name: CRACR2B
Alternative Gene Name: EFCAB4A, MGC45840
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048200: 77%, ENSRNOG00000050158: 77%
Entrez Gene ID: 283229
Uniprot ID: Q8N4Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEAVFESLDQAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLDVQGTAGSLDEE
• Gene Sequence: LEAVFESLDQAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLDVQGTAGSLDEE
• Gene ID - Mouse: ENSMUSG00000048200
• Gene ID - Rat: ENSRNOG00000050158
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.