Anti CRACR2B pAb (ATL-HPA046217 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046217-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: calcium release activated channel regulator 2B
Gene Name: CRACR2B
Alternative Gene Name: EFCAB4A, MGC45840
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048200: 77%, ENSRNOG00000050158: 77%
Entrez Gene ID: 283229
Uniprot ID: Q8N4Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEAVFESLDQAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLDVQGTAGSLDEE
Gene Sequence LEAVFESLDQAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLDVQGTAGSLDEE
Gene ID - Mouse ENSMUSG00000048200
Gene ID - Rat ENSRNOG00000050158
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRACR2B pAb (ATL-HPA046217 w/enhanced validation)
Datasheet Anti CRACR2B pAb (ATL-HPA046217 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRACR2B pAb (ATL-HPA046217 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CRACR2B pAb (ATL-HPA046217 w/enhanced validation)
Datasheet Anti CRACR2B pAb (ATL-HPA046217 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRACR2B pAb (ATL-HPA046217 w/enhanced validation)