Anti CRACR2A pAb (ATL-HPA038686 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA038686-25
  • Immunohistochemistry analysis in human salivary gland and cerebral cortex tissues using Anti-CRACR2A antibody. Corresponding CRACR2A RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium release activated channel regulator 2A
Gene Name: CRACR2A
Alternative Gene Name: EFCAB4B, MGC4266
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061414: 60%, ENSRNOG00000053449: 59%
Entrez Gene ID: 84766
Uniprot ID: Q9BSW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDA
Gene Sequence PDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDA
Gene ID - Mouse ENSMUSG00000061414
Gene ID - Rat ENSRNOG00000053449
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CRACR2A pAb (ATL-HPA038686 w/enhanced validation)
Datasheet Anti CRACR2A pAb (ATL-HPA038686 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRACR2A pAb (ATL-HPA038686 w/enhanced validation)