Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004135-25

Protein Description: cellular retinoic acid binding protein 2
Gene Name: CRABP2
Alternative Gene Name: CRABP-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004885: 95%, ENSRNOG00000022101: 95%
Entrez Gene ID: 1382
Uniprot ID: P29373
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
• Gene Sequence: IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
• Gene ID - Mouse: ENSMUSG00000004885
• Gene ID - Rat: ENSRNOG00000022101
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CRABP2 pAb (ATL-HPA004135 w/enhanced validation) – 2 Found

Seidensaal, Katharina; Nollert, Andre; Feige, Agnes Hiou; Muller, Marie; Fleming, Thomas; Gunkel, Nikolas; Zaoui, Karim; Grabe, Niels; Weichert, Wilko; Weber, Klaus-Josef; Plinkert, Peter; Simon, Christian; Hess, Jochen. Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma. Molecular Cancer. 2015;14( 26634247):204. 

Ozaki, Rie; Kuroda, Keiji; Ikemoto, Yuko; Ochiai, Asako; Matsumoto, Akemi; Kumakiri, Jun; Kitade, Mari; Itakura, Atsuo; Muter, Joanne; Brosens, Jan J; Takeda, Satoru. Reprogramming of the retinoic acid pathway in decidualizing human endometrial stromal cells. Plos One. 12(3):e0173035.