Anti CRABP1 pAb (ATL-HPA017203)

Atlas Antibodies

Catalog No.:
ATL-HPA017203-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cellular retinoic acid binding protein 1
Gene Name: CRABP1
Alternative Gene Name: CRABP, CRABP-I, CRABPI, RBP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032291: 99%, ENSRNOG00000023633: 99%
Entrez Gene ID: 1381
Uniprot ID: P29762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
Gene Sequence QFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
Gene ID - Mouse ENSMUSG00000032291
Gene ID - Rat ENSRNOG00000023633
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CRABP1 pAb (ATL-HPA017203)
Datasheet Anti CRABP1 pAb (ATL-HPA017203) Datasheet (External Link)
Vendor Page Anti CRABP1 pAb (ATL-HPA017203) at Atlas Antibodies

Documents & Links for Anti CRABP1 pAb (ATL-HPA017203)
Datasheet Anti CRABP1 pAb (ATL-HPA017203) Datasheet (External Link)
Vendor Page Anti CRABP1 pAb (ATL-HPA017203)
Citations for Anti CRABP1 pAb (ATL-HPA017203) – 1 Found
Kainov, Yaroslav; Favorskaya, Irina; Delektorskaya, Vera; Chemeris, Galina; Komelkov, Andrei; Zhuravskaya, Anna; Trukhanova, Lyubov; Zueva, Elina; Tavitian, Bertrand; Dyakova, Natalya; Zborovskaya, Irina; Tchevkina, Elena. CRABP1 provides high malignancy of transformed mesenchymal cells and contributes to the pathogenesis of mesenchymal and neuroendocrine tumors. Cell Cycle (Georgetown, Tex.). 13(10):1530-9.  PubMed