Anti CR2 pAb (ATL-HPA052942 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA052942-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: complement component (3d/Epstein Barr virus) receptor 2
Gene Name: CR2
Alternative Gene Name: CD21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026616: 64%, ENSRNOG00000034164: 65%
Entrez Gene ID: 1380
Uniprot ID: P20023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
Gene Sequence RLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
Gene ID - Mouse ENSMUSG00000026616
Gene ID - Rat ENSRNOG00000034164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CR2 pAb (ATL-HPA052942 w/enhanced validation)
Datasheet Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CR2 pAb (ATL-HPA052942 w/enhanced validation)
Datasheet Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CR2 pAb (ATL-HPA052942 w/enhanced validation)
Citations for Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) – 1 Found
Preisker, Sophie; Brethack, Ann-Kathrin; Bokemeyer, Arne; Bettenworth, Dominik; Sina, Christian; Derer, Stefanie. Crohn's Disease Patients in Remission Display an Enhanced Intestinal IgM⁺ B Cell Count in Concert with a Strong Activation of the Intestinal Complement System. Cells. 2019;8(1)  PubMed