Anti CR2 pAb (ATL-HPA052942 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052942-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CR2
Alternative Gene Name: CD21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026616: 64%, ENSRNOG00000034164: 65%
Entrez Gene ID: 1380
Uniprot ID: P20023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF |
| Gene Sequence | RLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF |
| Gene ID - Mouse | ENSMUSG00000026616 |
| Gene ID - Rat | ENSRNOG00000034164 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) | |
| Datasheet | Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) | |
| Datasheet | Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) |
| Citations for Anti CR2 pAb (ATL-HPA052942 w/enhanced validation) – 1 Found |
| Preisker, Sophie; Brethack, Ann-Kathrin; Bokemeyer, Arne; Bettenworth, Dominik; Sina, Christian; Derer, Stefanie. Crohn's Disease Patients in Remission Display an Enhanced Intestinal IgM⁺ B Cell Count in Concert with a Strong Activation of the Intestinal Complement System. Cells. 2019;8(1) PubMed |