Anti CR1 pAb (ATL-HPA049348)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049348-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CR1
Alternative Gene Name: CD35, KN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026616: 47%, ENSRNOG00000034164: 54%
Entrez Gene ID: 1378
Uniprot ID: P17927
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRG |
| Gene Sequence | VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRG |
| Gene ID - Mouse | ENSMUSG00000026616 |
| Gene ID - Rat | ENSRNOG00000034164 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CR1 pAb (ATL-HPA049348) | |
| Datasheet | Anti CR1 pAb (ATL-HPA049348) Datasheet (External Link) |
| Vendor Page | Anti CR1 pAb (ATL-HPA049348) at Atlas Antibodies |
| Documents & Links for Anti CR1 pAb (ATL-HPA049348) | |
| Datasheet | Anti CR1 pAb (ATL-HPA049348) Datasheet (External Link) |
| Vendor Page | Anti CR1 pAb (ATL-HPA049348) |
| Citations for Anti CR1 pAb (ATL-HPA049348) – 1 Found |
| Aid, Malika; Busman-Sahay, Kathleen; Vidal, Samuel J; Maliga, Zoltan; Bondoc, Stephen; Starke, Carly; Terry, Margaret; Jacobson, Connor A; Wrijil, Linda; Ducat, Sarah; Brook, Olga R; Miller, Andrew D; Porto, Maciel; Pellegrini, Kathryn L; Pino, Maria; Hoang, Timothy N; Chandrashekar, Abishek; Patel, Shivani; Stephenson, Kathryn; Bosinger, Steven E; Andersen, Hanne; Lewis, Mark G; Hecht, Jonathan L; Sorger, Peter K; Martinot, Amanda J; Estes, Jacob D; Barouch, Dan H. Vascular Disease and Thrombosis in SARS-CoV-2-Infected Rhesus Macaques. Cell. 2020;183(5):1354-1366.e13. PubMed |