Anti CR1 pAb (ATL-HPA049348)

Atlas Antibodies

Catalog No.:
ATL-HPA049348-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: complement component (3b/4b) receptor 1 (Knops blood group)
Gene Name: CR1
Alternative Gene Name: CD35, KN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026616: 47%, ENSRNOG00000034164: 54%
Entrez Gene ID: 1378
Uniprot ID: P17927
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRG
Gene Sequence VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRG
Gene ID - Mouse ENSMUSG00000026616
Gene ID - Rat ENSRNOG00000034164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CR1 pAb (ATL-HPA049348)
Datasheet Anti CR1 pAb (ATL-HPA049348) Datasheet (External Link)
Vendor Page Anti CR1 pAb (ATL-HPA049348) at Atlas Antibodies

Documents & Links for Anti CR1 pAb (ATL-HPA049348)
Datasheet Anti CR1 pAb (ATL-HPA049348) Datasheet (External Link)
Vendor Page Anti CR1 pAb (ATL-HPA049348)
Citations for Anti CR1 pAb (ATL-HPA049348) – 1 Found
Aid, Malika; Busman-Sahay, Kathleen; Vidal, Samuel J; Maliga, Zoltan; Bondoc, Stephen; Starke, Carly; Terry, Margaret; Jacobson, Connor A; Wrijil, Linda; Ducat, Sarah; Brook, Olga R; Miller, Andrew D; Porto, Maciel; Pellegrini, Kathryn L; Pino, Maria; Hoang, Timothy N; Chandrashekar, Abishek; Patel, Shivani; Stephenson, Kathryn; Bosinger, Steven E; Andersen, Hanne; Lewis, Mark G; Hecht, Jonathan L; Sorger, Peter K; Martinot, Amanda J; Estes, Jacob D; Barouch, Dan H. Vascular Disease and Thrombosis in SARS-CoV-2-Infected Rhesus Macaques. Cell. 2020;183(5):1354-1366.e13.  PubMed