Anti CR1 pAb (ATL-HPA042455 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042455-25

Protein Description: complement component (3b/4b) receptor 1 (Knops blood group)
Gene Name: CR1
Alternative Gene Name: CD35, KN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026616: 61%, ENSRNOG00000008193: 58%
Entrez Gene ID: 1378
Uniprot ID: P17927
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ
• Gene Sequence: LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ
• Gene ID - Mouse: ENSMUSG00000026616
• Gene ID - Rat: ENSRNOG00000008193
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.