Anti CR1 pAb (ATL-HPA042455 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA042455-25
  • Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using HPA042455 antibody. Corresponding CR1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: complement component (3b/4b) receptor 1 (Knops blood group)
Gene Name: CR1
Alternative Gene Name: CD35, KN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026616: 61%, ENSRNOG00000008193: 58%
Entrez Gene ID: 1378
Uniprot ID: P17927
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ
Gene Sequence LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ
Gene ID - Mouse ENSMUSG00000026616
Gene ID - Rat ENSRNOG00000008193
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CR1 pAb (ATL-HPA042455 w/enhanced validation)
Datasheet Anti CR1 pAb (ATL-HPA042455 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CR1 pAb (ATL-HPA042455 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CR1 pAb (ATL-HPA042455 w/enhanced validation)
Datasheet Anti CR1 pAb (ATL-HPA042455 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CR1 pAb (ATL-HPA042455 w/enhanced validation)