Anti CPZ pAb (ATL-HPA078608)

Atlas Antibodies

Catalog No.:
ATL-HPA078608-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: carboxypeptidase Z
Gene Name: CPZ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036596: 95%, ENSRNOG00000008947: 97%
Entrez Gene ID: 8532
Uniprot ID: Q66K79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNY
Gene Sequence SYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNY
Gene ID - Mouse ENSMUSG00000036596
Gene ID - Rat ENSRNOG00000008947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPZ pAb (ATL-HPA078608)
Datasheet Anti CPZ pAb (ATL-HPA078608) Datasheet (External Link)
Vendor Page Anti CPZ pAb (ATL-HPA078608) at Atlas Antibodies

Documents & Links for Anti CPZ pAb (ATL-HPA078608)
Datasheet Anti CPZ pAb (ATL-HPA078608) Datasheet (External Link)
Vendor Page Anti CPZ pAb (ATL-HPA078608)