Anti CPZ pAb (ATL-HPA078608)
Atlas Antibodies
- SKU:
- ATL-HPA078608-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CPZ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036596: 95%, ENSRNOG00000008947: 97%
Entrez Gene ID: 8532
Uniprot ID: Q66K79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNY |
Gene Sequence | SYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNY |
Gene ID - Mouse | ENSMUSG00000036596 |
Gene ID - Rat | ENSRNOG00000008947 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CPZ pAb (ATL-HPA078608) | |
Datasheet | Anti CPZ pAb (ATL-HPA078608) Datasheet (External Link) |
Vendor Page | Anti CPZ pAb (ATL-HPA078608) at Atlas Antibodies |
Documents & Links for Anti CPZ pAb (ATL-HPA078608) | |
Datasheet | Anti CPZ pAb (ATL-HPA078608) Datasheet (External Link) |
Vendor Page | Anti CPZ pAb (ATL-HPA078608) |