Anti CPT2 pAb (ATL-HPA028214)

Atlas Antibodies

Catalog No.:
ATL-HPA028214-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: carnitine palmitoyltransferase 2
Gene Name: CPT2
Alternative Gene Name: CPT1, CPTASE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028607: 92%, ENSRNOG00000012443: 87%
Entrez Gene ID: 1376
Uniprot ID: P23786
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKARHLLVLRKGNFYIFDVLDQDGNIVSPSE
Gene Sequence DTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKARHLLVLRKGNFYIFDVLDQDGNIVSPSE
Gene ID - Mouse ENSMUSG00000028607
Gene ID - Rat ENSRNOG00000012443
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPT2 pAb (ATL-HPA028214)
Datasheet Anti CPT2 pAb (ATL-HPA028214) Datasheet (External Link)
Vendor Page Anti CPT2 pAb (ATL-HPA028214) at Atlas Antibodies

Documents & Links for Anti CPT2 pAb (ATL-HPA028214)
Datasheet Anti CPT2 pAb (ATL-HPA028214) Datasheet (External Link)
Vendor Page Anti CPT2 pAb (ATL-HPA028214)