Anti CPT2 pAb (ATL-HPA028214)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028214-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CPT2
Alternative Gene Name: CPT1, CPTASE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028607: 92%, ENSRNOG00000012443: 87%
Entrez Gene ID: 1376
Uniprot ID: P23786
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKARHLLVLRKGNFYIFDVLDQDGNIVSPSE |
| Gene Sequence | DTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKARHLLVLRKGNFYIFDVLDQDGNIVSPSE |
| Gene ID - Mouse | ENSMUSG00000028607 |
| Gene ID - Rat | ENSRNOG00000012443 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CPT2 pAb (ATL-HPA028214) | |
| Datasheet | Anti CPT2 pAb (ATL-HPA028214) Datasheet (External Link) |
| Vendor Page | Anti CPT2 pAb (ATL-HPA028214) at Atlas Antibodies |
| Documents & Links for Anti CPT2 pAb (ATL-HPA028214) | |
| Datasheet | Anti CPT2 pAb (ATL-HPA028214) Datasheet (External Link) |
| Vendor Page | Anti CPT2 pAb (ATL-HPA028214) |