Anti CPT1C pAb (ATL-HPA063621)
Atlas Antibodies
- SKU:
- ATL-HPA063621-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CPT1C
Alternative Gene Name: CPT1P, CPTIC, FLJ23809
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007783: 91%, ENSRNOG00000026163: 81%
Entrez Gene ID: 126129
Uniprot ID: Q8TCG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAG |
Gene Sequence | AQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAG |
Gene ID - Mouse | ENSMUSG00000007783 |
Gene ID - Rat | ENSRNOG00000026163 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CPT1C pAb (ATL-HPA063621) | |
Datasheet | Anti CPT1C pAb (ATL-HPA063621) Datasheet (External Link) |
Vendor Page | Anti CPT1C pAb (ATL-HPA063621) at Atlas Antibodies |
Documents & Links for Anti CPT1C pAb (ATL-HPA063621) | |
Datasheet | Anti CPT1C pAb (ATL-HPA063621) Datasheet (External Link) |
Vendor Page | Anti CPT1C pAb (ATL-HPA063621) |