Anti CPT1B pAb (ATL-HPA079265 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA079265-25

• 

Protein Description: carnitine palmitoyltransferase 1B
Gene Name: CPT1B
Alternative Gene Name: CPT1-M, M-CPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078937: 88%, ENSRNOG00000010438: 84%
Entrez Gene ID: 1375
Uniprot ID: Q92523
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSW
• Gene Sequence: VPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSW
• Gene ID - Mouse: ENSMUSG00000078937
• Gene ID - Rat: ENSRNOG00000010438
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.