Anti CPSF7 pAb (ATL-HPA041094)

Atlas Antibodies

Catalog No.: ATL-HPA041094-100

Protein Description: cleavage and polyadenylation specific factor 7, 59kDa
Gene Name: CPSF7
Alternative Gene Name: FLJ12529
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034820: 97%, ENSRNOG00000020668: 97%
Entrez Gene ID: 79869
Uniprot ID: Q8N684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
• Gene Sequence: SDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
• Gene ID - Mouse: ENSMUSG00000034820
• Gene ID - Rat: ENSRNOG00000020668
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CPSF7 pAb (ATL-HPA041094) – 2 Found

Bejarano, David Alejandro; Peng, Ke; Laketa, Vibor; Börner, Kathleen; Jost, K Laurence; Lucic, Bojana; Glass, Bärbel; Lusic, Marina; Müller, Barbara; Kräusslich, Hans-Georg. HIV-1 nuclear import in macrophages is regulated by CPSF6-capsid interactions at the nuclear pore complex. Elife. 2019;8( 30672737) 

Tseng, Hsin-Wei; Mota-Sydor, Anthony; Leventis, Rania; Jovanovic, Predrag; Topisirovic, Ivan; Duchaine, Thomas F. Distinct, opposing functions for CFIm59 and CFIm68 in mRNA alternative polyadenylation of Pten and in the PI3K/Akt signalling cascade. Nucleic Acids Research. 2022;50(16):9397-9412.