Anti CPSF7 pAb (ATL-HPA041094)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041094-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: CPSF7
Alternative Gene Name: FLJ12529
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034820: 97%, ENSRNOG00000020668: 97%
Entrez Gene ID: 79869
Uniprot ID: Q8N684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA |
| Gene Sequence | SDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA |
| Gene ID - Mouse | ENSMUSG00000034820 |
| Gene ID - Rat | ENSRNOG00000020668 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CPSF7 pAb (ATL-HPA041094) | |
| Datasheet | Anti CPSF7 pAb (ATL-HPA041094) Datasheet (External Link) |
| Vendor Page | Anti CPSF7 pAb (ATL-HPA041094) at Atlas Antibodies |
| Documents & Links for Anti CPSF7 pAb (ATL-HPA041094) | |
| Datasheet | Anti CPSF7 pAb (ATL-HPA041094) Datasheet (External Link) |
| Vendor Page | Anti CPSF7 pAb (ATL-HPA041094) |
| Citations for Anti CPSF7 pAb (ATL-HPA041094) – 2 Found |
| Bejarano, David Alejandro; Peng, Ke; Laketa, Vibor; Börner, Kathleen; Jost, K Laurence; Lucic, Bojana; Glass, Bärbel; Lusic, Marina; Müller, Barbara; Kräusslich, Hans-Georg. HIV-1 nuclear import in macrophages is regulated by CPSF6-capsid interactions at the nuclear pore complex. Elife. 2019;8( 30672737) PubMed |
| Tseng, Hsin-Wei; Mota-Sydor, Anthony; Leventis, Rania; Jovanovic, Predrag; Topisirovic, Ivan; Duchaine, Thomas F. Distinct, opposing functions for CFIm59 and CFIm68 in mRNA alternative polyadenylation of Pten and in the PI3K/Akt signalling cascade. Nucleic Acids Research. 2022;50(16):9397-9412. PubMed |