Anti CPSF6 pAb (ATL-HPA039973)

Atlas Antibodies

SKU: ATL-HPA039973-25

• 
• 
• 

Protein Description: cleavage and polyadenylation specific factor 6, 68kDa
Gene Name: CPSF6
Alternative Gene Name: CFIM, CFIM68, HPBRII-4, HPBRII-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055531: 100%, ENSRNOG00000005927: 100%
Entrez Gene ID: 11052
Uniprot ID: Q16630
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN
• Gene Sequence: ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN
• Gene ID - Mouse: ENSMUSG00000055531
• Gene ID - Rat: ENSRNOG00000005927
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CPSF6 pAb (ATL-HPA039973) – 7 Found

Bejarano, David Alejandro; Peng, Ke; Laketa, Vibor; Börner, Kathleen; Jost, K Laurence; Lucic, Bojana; Glass, Bärbel; Lusic, Marina; Müller, Barbara; Kräusslich, Hans-Georg. HIV-1 nuclear import in macrophages is regulated by CPSF6-capsid interactions at the nuclear pore complex. Elife. 2019;8( 30672737) 

Müller, Thorsten G; Zila, Vojtech; Peters, Kyra; Schifferdecker, Sandra; Stanic, Mia; Lucic, Bojana; Laketa, Vibor; Lusic, Marina; Müller, Barbara; Kräusslich, Hans-Georg. HIV-1 uncoating by release of viral cDNA from capsid-like structures in the nucleus of infected cells. Elife. 2021;10( 33904396) 

Peng, Ke; Muranyi, Walter; Glass, Bärbel; Laketa, Vibor; Yant, Stephen R; Tsai, Luong; Cihlar, Tomas; Müller, Barbara; Kräusslich, Hans-Georg. Quantitative microscopy of functional HIV post-entry complexes reveals association of replication with the viral capsid. Elife. 2014;3( 25517934):e04114. 

Zila, Vojtech; Margiotta, Erica; Turoňová, Beata; Müller, Thorsten G; Zimmerli, Christian E; Mattei, Simone; Allegretti, Matteo; Börner, Kathleen; Rada, Jona; Müller, Barbara; Lusic, Marina; Kräusslich, Hans-Georg; Beck, Martin. Cone-shaped HIV-1 capsids are transported through intact nuclear pores. Cell. 2021;184(4):1032-1046.e18. 

Guedán, Anabel; Donaldson, Callum D; Caroe, Eve R; Cosnefroy, Ophélie; Taylor, Ian A; Bishop, Kate N. HIV-1 requires capsid remodelling at the nuclear pore for nuclear entry and integration. Plos Pathogens. 2021;17(9):e1009484. 

Janssens, Julie; Blokken, Jolien; Lampi, Yulia; De Wit, Flore; Zurnic Bonisch, Irena; Nombela, Ivan; Van de Velde, Paulien; Van Remoortel, Barbara; Gijsbers, Rik; Christ, Frauke; Debyser, Zeger. CRISPR/Cas9-Induced Mutagenesis Corroborates the Role of Transportin-SR2 in HIV-1 Nuclear Import. Microbiology Spectrum. 2021;9(2):e0133621. 

Schifferdecker, Sandra; Zila, Vojtech; Müller, Thorsten G; Sakin, Volkan; Anders-Össwein, Maria; Laketa, Vibor; Kräusslich, Hans-Georg; Müller, Barbara. Direct Capsid Labeling of Infectious HIV-1 by Genetic Code Expansion Allows Detection of Largely Complete Nuclear Capsids and Suggests Nuclear Entry of HIV-1 Complexes via Common Routes. Mbio. 2022;13(5):e0195922.