Anti CPSF6 pAb (ATL-HPA039973)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039973-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CPSF6
Alternative Gene Name: CFIM, CFIM68, HPBRII-4, HPBRII-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055531: 100%, ENSRNOG00000005927: 100%
Entrez Gene ID: 11052
Uniprot ID: Q16630
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN |
| Gene Sequence | ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN |
| Gene ID - Mouse | ENSMUSG00000055531 |
| Gene ID - Rat | ENSRNOG00000005927 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CPSF6 pAb (ATL-HPA039973) | |
| Datasheet | Anti CPSF6 pAb (ATL-HPA039973) Datasheet (External Link) |
| Vendor Page | Anti CPSF6 pAb (ATL-HPA039973) at Atlas Antibodies |
| Documents & Links for Anti CPSF6 pAb (ATL-HPA039973) | |
| Datasheet | Anti CPSF6 pAb (ATL-HPA039973) Datasheet (External Link) |
| Vendor Page | Anti CPSF6 pAb (ATL-HPA039973) |
| Citations for Anti CPSF6 pAb (ATL-HPA039973) – 7 Found |
| Bejarano, David Alejandro; Peng, Ke; Laketa, Vibor; Börner, Kathleen; Jost, K Laurence; Lucic, Bojana; Glass, Bärbel; Lusic, Marina; Müller, Barbara; Kräusslich, Hans-Georg. HIV-1 nuclear import in macrophages is regulated by CPSF6-capsid interactions at the nuclear pore complex. Elife. 2019;8( 30672737) PubMed |
| Müller, Thorsten G; Zila, Vojtech; Peters, Kyra; Schifferdecker, Sandra; Stanic, Mia; Lucic, Bojana; Laketa, Vibor; Lusic, Marina; Müller, Barbara; Kräusslich, Hans-Georg. HIV-1 uncoating by release of viral cDNA from capsid-like structures in the nucleus of infected cells. Elife. 2021;10( 33904396) PubMed |
| Peng, Ke; Muranyi, Walter; Glass, Bärbel; Laketa, Vibor; Yant, Stephen R; Tsai, Luong; Cihlar, Tomas; Müller, Barbara; Kräusslich, Hans-Georg. Quantitative microscopy of functional HIV post-entry complexes reveals association of replication with the viral capsid. Elife. 2014;3( 25517934):e04114. PubMed |
| Zila, Vojtech; Margiotta, Erica; Turoňová, Beata; Müller, Thorsten G; Zimmerli, Christian E; Mattei, Simone; Allegretti, Matteo; Börner, Kathleen; Rada, Jona; Müller, Barbara; Lusic, Marina; Kräusslich, Hans-Georg; Beck, Martin. Cone-shaped HIV-1 capsids are transported through intact nuclear pores. Cell. 2021;184(4):1032-1046.e18. PubMed |
| Guedán, Anabel; Donaldson, Callum D; Caroe, Eve R; Cosnefroy, Ophélie; Taylor, Ian A; Bishop, Kate N. HIV-1 requires capsid remodelling at the nuclear pore for nuclear entry and integration. Plos Pathogens. 2021;17(9):e1009484. PubMed |
| Janssens, Julie; Blokken, Jolien; Lampi, Yulia; De Wit, Flore; Zurnic Bonisch, Irena; Nombela, Ivan; Van de Velde, Paulien; Van Remoortel, Barbara; Gijsbers, Rik; Christ, Frauke; Debyser, Zeger. CRISPR/Cas9-Induced Mutagenesis Corroborates the Role of Transportin-SR2 in HIV-1 Nuclear Import. Microbiology Spectrum. 2021;9(2):e0133621. PubMed |
| Schifferdecker, Sandra; Zila, Vojtech; Müller, Thorsten G; Sakin, Volkan; Anders-Össwein, Maria; Laketa, Vibor; Kräusslich, Hans-Georg; Müller, Barbara. Direct Capsid Labeling of Infectious HIV-1 by Genetic Code Expansion Allows Detection of Largely Complete Nuclear Capsids and Suggests Nuclear Entry of HIV-1 Complexes via Common Routes. Mbio. 2022;13(5):e0195922. PubMed |