Anti CPSF4L pAb (ATL-HPA044047)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044047-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CPSF4L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018727: 80%, ENSRNOG00000056582: 76%
Entrez Gene ID: 642843
Uniprot ID: A6NMK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDR |
Gene Sequence | GLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDR |
Gene ID - Mouse | ENSMUSG00000018727 |
Gene ID - Rat | ENSRNOG00000056582 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CPSF4L pAb (ATL-HPA044047) | |
Datasheet | Anti CPSF4L pAb (ATL-HPA044047) Datasheet (External Link) |
Vendor Page | Anti CPSF4L pAb (ATL-HPA044047) at Atlas Antibodies |
Documents & Links for Anti CPSF4L pAb (ATL-HPA044047) | |
Datasheet | Anti CPSF4L pAb (ATL-HPA044047) Datasheet (External Link) |
Vendor Page | Anti CPSF4L pAb (ATL-HPA044047) |