Anti CPSF4L pAb (ATL-HPA044047)

Atlas Antibodies

Catalog No.:
ATL-HPA044047-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cleavage and polyadenylation specific factor 4-like
Gene Name: CPSF4L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018727: 80%, ENSRNOG00000056582: 76%
Entrez Gene ID: 642843
Uniprot ID: A6NMK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDR
Gene Sequence GLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDR
Gene ID - Mouse ENSMUSG00000018727
Gene ID - Rat ENSRNOG00000056582
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPSF4L pAb (ATL-HPA044047)
Datasheet Anti CPSF4L pAb (ATL-HPA044047) Datasheet (External Link)
Vendor Page Anti CPSF4L pAb (ATL-HPA044047) at Atlas Antibodies

Documents & Links for Anti CPSF4L pAb (ATL-HPA044047)
Datasheet Anti CPSF4L pAb (ATL-HPA044047) Datasheet (External Link)
Vendor Page Anti CPSF4L pAb (ATL-HPA044047)