Anti CPSF4 pAb (ATL-HPA049094)

Atlas Antibodies

Catalog No.:
ATL-HPA049094-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cleavage and polyadenylation specific factor 4, 30kDa
Gene Name: CPSF4
Alternative Gene Name: CPSF30, NAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029625: 100%, ENSRNOG00000000985: 100%
Entrez Gene ID: 10898
Uniprot ID: O95639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKT
Gene Sequence MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKT
Gene ID - Mouse ENSMUSG00000029625
Gene ID - Rat ENSRNOG00000000985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPSF4 pAb (ATL-HPA049094)
Datasheet Anti CPSF4 pAb (ATL-HPA049094) Datasheet (External Link)
Vendor Page Anti CPSF4 pAb (ATL-HPA049094) at Atlas Antibodies

Documents & Links for Anti CPSF4 pAb (ATL-HPA049094)
Datasheet Anti CPSF4 pAb (ATL-HPA049094) Datasheet (External Link)
Vendor Page Anti CPSF4 pAb (ATL-HPA049094)