Anti CPS1 pAb (ATL-HPA021400 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA021400-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: carbamoyl-phosphate synthase 1, mitochondrial
Gene Name: CPS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025991: 98%, ENSRNOG00000013704: 97%
Entrez Gene ID: 1373
Uniprot ID: P31327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSA
Gene Sequence FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSA
Gene ID - Mouse ENSMUSG00000025991
Gene ID - Rat ENSRNOG00000013704
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPS1 pAb (ATL-HPA021400 w/enhanced validation)
Datasheet Anti CPS1 pAb (ATL-HPA021400 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPS1 pAb (ATL-HPA021400 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CPS1 pAb (ATL-HPA021400 w/enhanced validation)
Datasheet Anti CPS1 pAb (ATL-HPA021400 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPS1 pAb (ATL-HPA021400 w/enhanced validation)
Citations for Anti CPS1 pAb (ATL-HPA021400 w/enhanced validation) – 2 Found
Kim, Jiyeon; Hu, Zeping; Cai, Ling; Li, Kailong; Choi, Eunhee; Faubert, Brandon; Bezwada, Divya; Rodriguez-Canales, Jaime; Villalobos, Pamela; Lin, Yu-Fen; Ni, Min; Huffman, Kenneth E; Girard, Luc; Byers, Lauren A; Unsal-Kacmaz, Keziban; Peña, Christopher G; Heymach, John V; Wauters, Els; Vansteenkiste, Johan; Castrillon, Diego H; Chen, Benjamin P C; Wistuba, Ignacio; Lambrechts, Diether; Xu, Jian; Minna, John D; DeBerardinis, Ralph J. CPS1 maintains pyrimidine pools and DNA synthesis in KRAS/LKB1-mutant lung cancer cells. Nature. 2017;546(7656):168-172.  PubMed
van Straten, Giora; van Steenbeek, Frank G; Grinwis, Guy C M; Favier, Robert P; Kummeling, Anne; van Gils, Ingrid H; Fieten, Hille; Groot Koerkamp, Marian J A; Holstege, Frank C P; Rothuizen, Jan; Spee, Bart. Aberrant expression and distribution of enzymes of the urea cycle and other ammonia metabolizing pathways in dogs with congenital portosystemic shunts. Plos One. 9(6):e100077.  PubMed