Anti CPQ pAb (ATL-HPA024490 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024490-25
  • Immunohistochemistry analysis in human thyroid gland and cerebral cortex tissues using Anti-CPQ antibody. Corresponding CPQ RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: carboxypeptidase Q
Gene Name: CPQ
Alternative Gene Name: LDP, PGCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039007: 86%, ENSRNOG00000005931: 85%
Entrez Gene ID: 10404
Uniprot ID: Q9Y646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMG
Gene Sequence NQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMG
Gene ID - Mouse ENSMUSG00000039007
Gene ID - Rat ENSRNOG00000005931
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CPQ pAb (ATL-HPA024490 w/enhanced validation)
Datasheet Anti CPQ pAb (ATL-HPA024490 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPQ pAb (ATL-HPA024490 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CPQ pAb (ATL-HPA024490 w/enhanced validation)
Datasheet Anti CPQ pAb (ATL-HPA024490 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPQ pAb (ATL-HPA024490 w/enhanced validation)