Anti CPQ pAb (ATL-HPA023235 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023235-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CPQ
Alternative Gene Name: LDP, PGCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039007: 94%, ENSRNOG00000005931: 91%
Entrez Gene ID: 10404
Uniprot ID: Q9Y646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPE |
| Gene Sequence | YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPE |
| Gene ID - Mouse | ENSMUSG00000039007 |
| Gene ID - Rat | ENSRNOG00000005931 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CPQ pAb (ATL-HPA023235 w/enhanced validation) | |
| Datasheet | Anti CPQ pAb (ATL-HPA023235 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CPQ pAb (ATL-HPA023235 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CPQ pAb (ATL-HPA023235 w/enhanced validation) | |
| Datasheet | Anti CPQ pAb (ATL-HPA023235 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CPQ pAb (ATL-HPA023235 w/enhanced validation) |
| Citations for Anti CPQ pAb (ATL-HPA023235 w/enhanced validation) – 1 Found |
| Lee, Jae-Hye; Cho, Hyun-Soo; Lee, Jeong-Ju; Jun, Soo Young; Ahn, Jun-Ho; Min, Ju-Sik; Yoon, Ji-Yong; Choi, Min-Hyuk; Jeon, Su-Jin; Lim, Jung Hwa; Jung, Cho-Rok; Kim, Dae-Soo; Kim, Hyun-Taek; Factor, Valentina M; Lee, Yun-Han; Thorgeirsson, Snorri S; Kim, Cheol-Hee; Kim, Nam-Soon. Plasma glutamate carboxypeptidase is a negative regulator in liver cancer metastasis. Oncotarget. 2016;7(48):79774-79786. PubMed |