Anti CPQ pAb (ATL-HPA023235 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023235-25

• 
• 

Protein Description: carboxypeptidase Q
Gene Name: CPQ
Alternative Gene Name: LDP, PGCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039007: 94%, ENSRNOG00000005931: 91%
Entrez Gene ID: 10404
Uniprot ID: Q9Y646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPE
• Gene Sequence: YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPE
• Gene ID - Mouse: ENSMUSG00000039007
• Gene ID - Rat: ENSRNOG00000005931
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CPQ pAb (ATL-HPA023235 w/enhanced validation) – 1 Found

Lee, Jae-Hye; Cho, Hyun-Soo; Lee, Jeong-Ju; Jun, Soo Young; Ahn, Jun-Ho; Min, Ju-Sik; Yoon, Ji-Yong; Choi, Min-Hyuk; Jeon, Su-Jin; Lim, Jung Hwa; Jung, Cho-Rok; Kim, Dae-Soo; Kim, Hyun-Taek; Factor, Valentina M; Lee, Yun-Han; Thorgeirsson, Snorri S; Kim, Cheol-Hee; Kim, Nam-Soon. Plasma glutamate carboxypeptidase is a negative regulator in liver cancer metastasis. Oncotarget. 2016;7(48):79774-79786.