Anti CPPED1 pAb (ATL-HPA041970)

Atlas Antibodies

Catalog No.: ATL-HPA041970-25

Protein Description: calcineurin-like phosphoesterase domain containing 1
Gene Name: CPPED1
Alternative Gene Name: CSTP1, FLJ11151
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000065979: 77%, ENSRNOG00000015118: 80%
Entrez Gene ID: 55313
Uniprot ID: Q9BRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDDYYFNLSKSTRKKLADKFIHAGVRVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRVVVVTAEKIVHRYYSLDELSEKGIEDDLMDL
• Gene Sequence: DDDYYFNLSKSTRKKLADKFIHAGVRVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRVVVVTAEKIVHRYYSLDELSEKGIEDDLMDL
• Gene ID - Mouse: ENSMUSG00000065979
• Gene ID - Rat: ENSRNOG00000015118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.