Anti CPPED1 pAb (ATL-HPA041970)

Atlas Antibodies

SKU:
ATL-HPA041970-25
  • Immunofluorescent staining of human cell line A549 shows localization to cytosol.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcineurin-like phosphoesterase domain containing 1
Gene Name: CPPED1
Alternative Gene Name: CSTP1, FLJ11151
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000065979: 77%, ENSRNOG00000015118: 80%
Entrez Gene ID: 55313
Uniprot ID: Q9BRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDDYYFNLSKSTRKKLADKFIHAGVRVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRVVVVTAEKIVHRYYSLDELSEKGIEDDLMDL
Gene Sequence DDDYYFNLSKSTRKKLADKFIHAGVRVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRVVVVTAEKIVHRYYSLDELSEKGIEDDLMDL
Gene ID - Mouse ENSMUSG00000065979
Gene ID - Rat ENSRNOG00000015118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CPPED1 pAb (ATL-HPA041970)
Datasheet Anti CPPED1 pAb (ATL-HPA041970) Datasheet (External Link)
Vendor Page Anti CPPED1 pAb (ATL-HPA041970) at Atlas Antibodies

Documents & Links for Anti CPPED1 pAb (ATL-HPA041970)
Datasheet Anti CPPED1 pAb (ATL-HPA041970) Datasheet (External Link)
Vendor Page Anti CPPED1 pAb (ATL-HPA041970)