Anti CPPED1 pAb (ATL-HPA040938 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA040938-25

• 
• 

Protein Description: calcineurin-like phosphoesterase domain containing 1
Gene Name: CPPED1
Alternative Gene Name: CSTP1, FLJ11151
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000065979: 82%, ENSRNOG00000015118: 83%
Entrez Gene ID: 55313
Uniprot ID: Q9BRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSDAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMP
• Gene Sequence: MSDAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMP
• Gene ID - Mouse: ENSMUSG00000065979
• Gene ID - Rat: ENSRNOG00000015118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CPPED1 pAb (ATL-HPA040938 w/enhanced validation) – 1 Found

Haapalainen, Antti M; Karjalainen, Minna K; Daddali, Ravindra; Ohlmeier, Steffen; Anttonen, Julia; Määttä, Tomi A; Salminen, Annamari; Mahlman, Mari; Bergmann, Ulrich; Mäkikallio, Kaarin; Ojaniemi, Marja; Hallman, Mikko; Rämet, Mika. Expression of CPPED1 in human trophoblasts is associated with timing of term birth. Journal Of Cellular And Molecular Medicine. 2018;22(2):968-981.