Anti CPNE8 pAb (ATL-HPA038600)
Atlas Antibodies
- SKU:
- ATL-HPA038600-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CPNE8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052560: 92%, ENSRNOG00000026128: 92%
Entrez Gene ID: 144402
Uniprot ID: Q86YQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLL |
Gene Sequence | MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLL |
Gene ID - Mouse | ENSMUSG00000052560 |
Gene ID - Rat | ENSRNOG00000026128 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CPNE8 pAb (ATL-HPA038600) | |
Datasheet | Anti CPNE8 pAb (ATL-HPA038600) Datasheet (External Link) |
Vendor Page | Anti CPNE8 pAb (ATL-HPA038600) at Atlas Antibodies |
Documents & Links for Anti CPNE8 pAb (ATL-HPA038600) | |
Datasheet | Anti CPNE8 pAb (ATL-HPA038600) Datasheet (External Link) |
Vendor Page | Anti CPNE8 pAb (ATL-HPA038600) |