Anti CPNE8 pAb (ATL-HPA038600)

Atlas Antibodies

Catalog No.:
ATL-HPA038600-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: copine VIII
Gene Name: CPNE8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052560: 92%, ENSRNOG00000026128: 92%
Entrez Gene ID: 144402
Uniprot ID: Q86YQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLL
Gene Sequence MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLL
Gene ID - Mouse ENSMUSG00000052560
Gene ID - Rat ENSRNOG00000026128
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPNE8 pAb (ATL-HPA038600)
Datasheet Anti CPNE8 pAb (ATL-HPA038600) Datasheet (External Link)
Vendor Page Anti CPNE8 pAb (ATL-HPA038600) at Atlas Antibodies

Documents & Links for Anti CPNE8 pAb (ATL-HPA038600)
Datasheet Anti CPNE8 pAb (ATL-HPA038600) Datasheet (External Link)
Vendor Page Anti CPNE8 pAb (ATL-HPA038600)