Anti CPNE7 pAb (ATL-HPA043359)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043359-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CPNE7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034796: 81%, ENSRNOG00000015397: 83%
Entrez Gene ID: 27132
Uniprot ID: Q9UBL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSTTFEEMQKAFEEGQAQWDCVNPKYKQKRRSYKNSGVVVLADLKFHRVYSF |
Gene Sequence | FSTTFEEMQKAFEEGQAQWDCVNPKYKQKRRSYKNSGVVVLADLKFHRVYSF |
Gene ID - Mouse | ENSMUSG00000034796 |
Gene ID - Rat | ENSRNOG00000015397 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CPNE7 pAb (ATL-HPA043359) | |
Datasheet | Anti CPNE7 pAb (ATL-HPA043359) Datasheet (External Link) |
Vendor Page | Anti CPNE7 pAb (ATL-HPA043359) at Atlas Antibodies |
Documents & Links for Anti CPNE7 pAb (ATL-HPA043359) | |
Datasheet | Anti CPNE7 pAb (ATL-HPA043359) Datasheet (External Link) |
Vendor Page | Anti CPNE7 pAb (ATL-HPA043359) |