Anti CPNE7 pAb (ATL-HPA043359)

Atlas Antibodies

Catalog No.:
ATL-HPA043359-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: copine VII
Gene Name: CPNE7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034796: 81%, ENSRNOG00000015397: 83%
Entrez Gene ID: 27132
Uniprot ID: Q9UBL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSTTFEEMQKAFEEGQAQWDCVNPKYKQKRRSYKNSGVVVLADLKFHRVYSF
Gene Sequence FSTTFEEMQKAFEEGQAQWDCVNPKYKQKRRSYKNSGVVVLADLKFHRVYSF
Gene ID - Mouse ENSMUSG00000034796
Gene ID - Rat ENSRNOG00000015397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPNE7 pAb (ATL-HPA043359)
Datasheet Anti CPNE7 pAb (ATL-HPA043359) Datasheet (External Link)
Vendor Page Anti CPNE7 pAb (ATL-HPA043359) at Atlas Antibodies

Documents & Links for Anti CPNE7 pAb (ATL-HPA043359)
Datasheet Anti CPNE7 pAb (ATL-HPA043359) Datasheet (External Link)
Vendor Page Anti CPNE7 pAb (ATL-HPA043359)