Anti CPNE5 pAb (ATL-HPA031369 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031369-25

Protein Description: copine V
Gene Name: CPNE5
Alternative Gene Name: COPN5, CPN5, KIAA1599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024008: 100%, ENSRNOG00000000522: 98%
Entrez Gene ID: 57699
Uniprot ID: Q9HCH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQW
• Gene Sequence: MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQW
• Gene ID - Mouse: ENSMUSG00000024008
• Gene ID - Rat: ENSRNOG00000000522
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.