Anti CPNE5 pAb (ATL-HPA031369 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA031369-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: copine V
Gene Name: CPNE5
Alternative Gene Name: COPN5, CPN5, KIAA1599
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024008: 100%, ENSRNOG00000000522: 98%
Entrez Gene ID: 57699
Uniprot ID: Q9HCH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQW
Gene Sequence MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQW
Gene ID - Mouse ENSMUSG00000024008
Gene ID - Rat ENSRNOG00000000522
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPNE5 pAb (ATL-HPA031369 w/enhanced validation)
Datasheet Anti CPNE5 pAb (ATL-HPA031369 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPNE5 pAb (ATL-HPA031369 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CPNE5 pAb (ATL-HPA031369 w/enhanced validation)
Datasheet Anti CPNE5 pAb (ATL-HPA031369 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPNE5 pAb (ATL-HPA031369 w/enhanced validation)