Anti CPNE4 pAb (ATL-HPA078300 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA078300-25

Protein Description: copine 4
Gene Name: CPNE4
Alternative Gene Name: COPN4, CPN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032564: 97%, ENSRNOG00000026577: 97%
Entrez Gene ID: 131034
Uniprot ID: Q96A23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP
• Gene Sequence: AEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP
• Gene ID - Mouse: ENSMUSG00000032564
• Gene ID - Rat: ENSRNOG00000026577
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.