Anti CPNE2 pAb (ATL-HPA041132)

Atlas Antibodies

Catalog No.:
ATL-HPA041132-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: copine II
Gene Name: CPNE2
Alternative Gene Name: CPN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034361: 98%, ENSRNOG00000043286: 98%
Entrez Gene ID: 221184
Uniprot ID: Q96FN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCY
Gene Sequence YKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCY
Gene ID - Mouse ENSMUSG00000034361
Gene ID - Rat ENSRNOG00000043286
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPNE2 pAb (ATL-HPA041132)
Datasheet Anti CPNE2 pAb (ATL-HPA041132) Datasheet (External Link)
Vendor Page Anti CPNE2 pAb (ATL-HPA041132) at Atlas Antibodies

Documents & Links for Anti CPNE2 pAb (ATL-HPA041132)
Datasheet Anti CPNE2 pAb (ATL-HPA041132) Datasheet (External Link)
Vendor Page Anti CPNE2 pAb (ATL-HPA041132)