Anti-CPNE1 pAb (ATL-HPA065876)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065876-100
- Shipping:
- Calculated at Checkout
$596.00
| Product Specifications | |
| Application | ICC, WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS |
| Gene Sequence | KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS |
| Gene ID - Mouse | ENSMUSG00000074643 |
| Gene ID - Rat | ENSRNOG00000050864 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-CPNE1 pAb (ATL-HPA065876) | |
| Vendor Page | Anti-CPNE1 pAb (ATL-HPA065876) at Atlas Antibodies |
| Documents & Links for Anti-CPNE1 pAb (ATL-HPA065876) | |
| Vendor Page | Anti-CPNE1 pAb (ATL-HPA065876) |