Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047259-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CPNE1
Alternative Gene Name: CPN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074643: 87%, ENSRNOG00000046990: 85%
Entrez Gene ID: 8904
Uniprot ID: Q99829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS |
Gene Sequence | KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS |
Gene ID - Mouse | ENSMUSG00000074643 |
Gene ID - Rat | ENSRNOG00000046990 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation) | |
Datasheet | Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation) | |
Datasheet | Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CPNE1 pAb (ATL-HPA047259 w/enhanced validation) |