Anti CPEB4 pAb (ATL-HPA038394)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038394-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CPEB4
Alternative Gene Name: KIAA1673
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020300: 98%, ENSRNOG00000033169: 98%
Entrez Gene ID: 80315
Uniprot ID: Q17RY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSA |
| Gene Sequence | GDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSA |
| Gene ID - Mouse | ENSMUSG00000020300 |
| Gene ID - Rat | ENSRNOG00000033169 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CPEB4 pAb (ATL-HPA038394) | |
| Datasheet | Anti CPEB4 pAb (ATL-HPA038394) Datasheet (External Link) |
| Vendor Page | Anti CPEB4 pAb (ATL-HPA038394) at Atlas Antibodies |
| Documents & Links for Anti CPEB4 pAb (ATL-HPA038394) | |
| Datasheet | Anti CPEB4 pAb (ATL-HPA038394) Datasheet (External Link) |
| Vendor Page | Anti CPEB4 pAb (ATL-HPA038394) |
| Citations for Anti CPEB4 pAb (ATL-HPA038394) – 1 Found |
| Zeng, Manli; Li, Fen; Wang, Lei; Chen, Chen; Huang, Xiaolin; Wu, Xingyu; She, Wensheng; Zhou, Lin; Tao, Zezhang. Downregulated cytoplasmic polyadenylation element-binding protein-4 is associated with the carcinogenesis of head and neck squamous cell carcinoma. Oncology Letters. 2018;15(3):3226-3232. PubMed |