Anti CPEB4 pAb (ATL-HPA038394)

Atlas Antibodies

Catalog No.: ATL-HPA038394-25

Protein Description: cytoplasmic polyadenylation element binding protein 4
Gene Name: CPEB4
Alternative Gene Name: KIAA1673
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020300: 98%, ENSRNOG00000033169: 98%
Entrez Gene ID: 80315
Uniprot ID: Q17RY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSA
• Gene Sequence: GDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSA
• Gene ID - Mouse: ENSMUSG00000020300
• Gene ID - Rat: ENSRNOG00000033169
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CPEB4 pAb (ATL-HPA038394) – 1 Found

Zeng, Manli; Li, Fen; Wang, Lei; Chen, Chen; Huang, Xiaolin; Wu, Xingyu; She, Wensheng; Zhou, Lin; Tao, Zezhang. Downregulated cytoplasmic polyadenylation element-binding protein-4 is associated with the carcinogenesis of head and neck squamous cell carcinoma. Oncology Letters. 2018;15(3):3226-3232.