Anti CPEB1 pAb (ATL-HPA040396)

Atlas Antibodies

SKU:
ATL-HPA040396-25
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytoplasmic polyadenylation element binding protein 1
Gene Name: CPEB1
Alternative Gene Name: CPEB, FLJ13203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025586: 93%, ENSRNOG00000019161: 90%
Entrez Gene ID: 64506
Uniprot ID: Q9BZB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLC
Gene Sequence WDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLC
Gene ID - Mouse ENSMUSG00000025586
Gene ID - Rat ENSRNOG00000019161
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CPEB1 pAb (ATL-HPA040396)
Datasheet Anti CPEB1 pAb (ATL-HPA040396) Datasheet (External Link)
Vendor Page Anti CPEB1 pAb (ATL-HPA040396) at Atlas Antibodies

Documents & Links for Anti CPEB1 pAb (ATL-HPA040396)
Datasheet Anti CPEB1 pAb (ATL-HPA040396) Datasheet (External Link)
Vendor Page Anti CPEB1 pAb (ATL-HPA040396)