Anti CPB2 pAb (ATL-HPA004146)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004146-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CPB2
Alternative Gene Name: CPU, PCPB, TAFI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021999: 84%, ENSRNOG00000010935: 81%
Entrez Gene ID: 1361
Uniprot ID: Q96IY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERHPDMLTKIHIGSSFEKYPLYVLKVSGKEQAA |
| Gene Sequence | QVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERHPDMLTKIHIGSSFEKYPLYVLKVSGKEQAA |
| Gene ID - Mouse | ENSMUSG00000021999 |
| Gene ID - Rat | ENSRNOG00000010935 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CPB2 pAb (ATL-HPA004146) | |
| Datasheet | Anti CPB2 pAb (ATL-HPA004146) Datasheet (External Link) |
| Vendor Page | Anti CPB2 pAb (ATL-HPA004146) at Atlas Antibodies |
| Documents & Links for Anti CPB2 pAb (ATL-HPA004146) | |
| Datasheet | Anti CPB2 pAb (ATL-HPA004146) Datasheet (External Link) |
| Vendor Page | Anti CPB2 pAb (ATL-HPA004146) |
| Citations for Anti CPB2 pAb (ATL-HPA004146) – 1 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |