Anti CPAMD8 pAb (ATL-HPA031328)

Atlas Antibodies

Catalog No.:
ATL-HPA031328-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: C3 and PZP-like, alpha-2-macroglobulin domain containing 8
Gene Name: CPAMD8
Alternative Gene Name: K-CAP, KIAA1283, VIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030359: 42%, ENSRNOG00000006709: 42%
Entrez Gene ID: 27151
Uniprot ID: Q8IZJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPETWIWHCLNISDPSGEGTLSVKVPDSITSWVGEAVALSTSQGLGIAEPSLLKTFKPFFVDFMLPALIIRGEQVKIPLSVYNYMGTCAEVYMKLSVPK
Gene Sequence FPETWIWHCLNISDPSGEGTLSVKVPDSITSWVGEAVALSTSQGLGIAEPSLLKTFKPFFVDFMLPALIIRGEQVKIPLSVYNYMGTCAEVYMKLSVPK
Gene ID - Mouse ENSMUSG00000030359
Gene ID - Rat ENSRNOG00000006709
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPAMD8 pAb (ATL-HPA031328)
Datasheet Anti CPAMD8 pAb (ATL-HPA031328) Datasheet (External Link)
Vendor Page Anti CPAMD8 pAb (ATL-HPA031328) at Atlas Antibodies

Documents & Links for Anti CPAMD8 pAb (ATL-HPA031328)
Datasheet Anti CPAMD8 pAb (ATL-HPA031328) Datasheet (External Link)
Vendor Page Anti CPAMD8 pAb (ATL-HPA031328)
Citations for Anti CPAMD8 pAb (ATL-HPA031328) – 1 Found
Hollmann, Anne K; Dammann, Insa; Wemheuer, Wiebke M; Wemheuer, Wilhelm E; Chilla, Almuth; Tipold, Andrea; Schulz-Schaeffer, Walter J; Beck, Julia; Schütz, Ekkehard; Brenig, Bertram. Morgagnian cataract resulting from a naturally occurring nonsense mutation elucidates a role of CPAMD8 in mammalian lens development. Plos One. 12(7):e0180665.  PubMed