Anti CPAMD8 pAb (ATL-HPA031327)

Atlas Antibodies

Catalog No.: ATL-HPA031327-25

Protein Description: C3 and PZP-like, alpha-2-macroglobulin domain containing 8
Gene Name: CPAMD8
Alternative Gene Name: K-CAP, KIAA1283, VIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047228: 28%, ENSRNOG00000025453: 30%
Entrez Gene ID: 27151
Uniprot ID: Q8IZJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSG
• Gene Sequence: YLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSG
• Gene ID - Mouse: ENSMUSG00000047228
• Gene ID - Rat: ENSRNOG00000025453
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CPAMD8 pAb (ATL-HPA031327) – 1 Found

Hollmann, Anne K; Dammann, Insa; Wemheuer, Wiebke M; Wemheuer, Wilhelm E; Chilla, Almuth; Tipold, Andrea; Schulz-Schaeffer, Walter J; Beck, Julia; Schütz, Ekkehard; Brenig, Bertram. Morgagnian cataract resulting from a naturally occurring nonsense mutation elucidates a role of CPAMD8 in mammalian lens development. Plos One. 12(7):e0180665.