Anti CPAMD8 pAb (ATL-HPA031327)
Atlas Antibodies
- SKU:
- ATL-HPA031327-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CPAMD8
Alternative Gene Name: K-CAP, KIAA1283, VIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047228: 28%, ENSRNOG00000025453: 30%
Entrez Gene ID: 27151
Uniprot ID: Q8IZJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSG |
| Gene Sequence | YLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSG |
| Gene ID - Mouse | ENSMUSG00000047228 |
| Gene ID - Rat | ENSRNOG00000025453 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CPAMD8 pAb (ATL-HPA031327) | |
| Datasheet | Anti CPAMD8 pAb (ATL-HPA031327) Datasheet (External Link) |
| Vendor Page | Anti CPAMD8 pAb (ATL-HPA031327) at Atlas Antibodies |
| Documents & Links for Anti CPAMD8 pAb (ATL-HPA031327) | |
| Datasheet | Anti CPAMD8 pAb (ATL-HPA031327) Datasheet (External Link) |
| Vendor Page | Anti CPAMD8 pAb (ATL-HPA031327) |
| Citations for Anti CPAMD8 pAb (ATL-HPA031327) – 1 Found |
| Hollmann, Anne K; Dammann, Insa; Wemheuer, Wiebke M; Wemheuer, Wilhelm E; Chilla, Almuth; Tipold, Andrea; Schulz-Schaeffer, Walter J; Beck, Julia; Schütz, Ekkehard; Brenig, Bertram. Morgagnian cataract resulting from a naturally occurring nonsense mutation elucidates a role of CPAMD8 in mammalian lens development. Plos One. 12(7):e0180665. PubMed |