Anti CPAMD8 pAb (ATL-HPA031327)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031327-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CPAMD8
Alternative Gene Name: K-CAP, KIAA1283, VIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047228: 28%, ENSRNOG00000025453: 30%
Entrez Gene ID: 27151
Uniprot ID: Q8IZJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSG |
Gene Sequence | YLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSG |
Gene ID - Mouse | ENSMUSG00000047228 |
Gene ID - Rat | ENSRNOG00000025453 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CPAMD8 pAb (ATL-HPA031327) | |
Datasheet | Anti CPAMD8 pAb (ATL-HPA031327) Datasheet (External Link) |
Vendor Page | Anti CPAMD8 pAb (ATL-HPA031327) at Atlas Antibodies |
Documents & Links for Anti CPAMD8 pAb (ATL-HPA031327) | |
Datasheet | Anti CPAMD8 pAb (ATL-HPA031327) Datasheet (External Link) |
Vendor Page | Anti CPAMD8 pAb (ATL-HPA031327) |
Citations for Anti CPAMD8 pAb (ATL-HPA031327) – 1 Found |
Hollmann, Anne K; Dammann, Insa; Wemheuer, Wiebke M; Wemheuer, Wilhelm E; Chilla, Almuth; Tipold, Andrea; Schulz-Schaeffer, Walter J; Beck, Julia; Schütz, Ekkehard; Brenig, Bertram. Morgagnian cataract resulting from a naturally occurring nonsense mutation elucidates a role of CPAMD8 in mammalian lens development. Plos One. 12(7):e0180665. PubMed |