Anti CPA5 pAb (ATL-HPA020322)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020322-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CPA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029788: 92%, ENSRNOG00000010467: 88%
Entrez Gene ID: 93979
Uniprot ID: Q8WXQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYHT |
Gene Sequence | SLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYHT |
Gene ID - Mouse | ENSMUSG00000029788 |
Gene ID - Rat | ENSRNOG00000010467 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CPA5 pAb (ATL-HPA020322) | |
Datasheet | Anti CPA5 pAb (ATL-HPA020322) Datasheet (External Link) |
Vendor Page | Anti CPA5 pAb (ATL-HPA020322) at Atlas Antibodies |
Documents & Links for Anti CPA5 pAb (ATL-HPA020322) | |
Datasheet | Anti CPA5 pAb (ATL-HPA020322) Datasheet (External Link) |
Vendor Page | Anti CPA5 pAb (ATL-HPA020322) |