Anti CPA5 pAb (ATL-HPA020322)

Atlas Antibodies

Catalog No.:
ATL-HPA020322-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: carboxypeptidase A5
Gene Name: CPA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029788: 92%, ENSRNOG00000010467: 88%
Entrez Gene ID: 93979
Uniprot ID: Q8WXQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYHT
Gene Sequence SLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYHT
Gene ID - Mouse ENSMUSG00000029788
Gene ID - Rat ENSRNOG00000010467
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CPA5 pAb (ATL-HPA020322)
Datasheet Anti CPA5 pAb (ATL-HPA020322) Datasheet (External Link)
Vendor Page Anti CPA5 pAb (ATL-HPA020322) at Atlas Antibodies

Documents & Links for Anti CPA5 pAb (ATL-HPA020322)
Datasheet Anti CPA5 pAb (ATL-HPA020322) Datasheet (External Link)
Vendor Page Anti CPA5 pAb (ATL-HPA020322)