Anti CPA4 pAb (ATL-HPA021030)

Atlas Antibodies

SKU: ATL-HPA021030-25

• 

Protein Description: carboxypeptidase A4
Gene Name: CPA4
Alternative Gene Name: CPA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039070: 79%, ENSRNOG00000010463: 75%
Entrez Gene ID: 51200
Uniprot ID: Q9UI42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFP
• Gene Sequence: QVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFP
• Gene ID - Mouse: ENSMUSG00000039070
• Gene ID - Rat: ENSRNOG00000010463
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CPA4 pAb (ATL-HPA021030) – 5 Found

Sun, Lichao; Burnett, Joseph; Guo, Chunguang; Xie, Yibin; Pan, Jian; Yang, Zhihua; Ran, Yuliang; Sun, Duxin. CPA4 is a promising diagnostic serum biomarker for pancreatic cancer. American Journal Of Cancer Research. 6(1):91-6. 

Handa, Tadashi; Katayama, Ayaka; Yokobori, Takehiko; Yamane, Arito; Fujii, Takaaki; Obayashi, Sayaka; Kurozumi, Sasagu; Kawabata-Iwakawa, Reika; Gombodorj, Navchaa; Nishiyama, Masahiko; Asao, Takayuki; Shirabe, Ken; Kuwano, Hiroyuki; Oyama, Tetsunari. Carboxypeptidase A4 accumulation is associated with an aggressive phenotype and poor prognosis in triple-negative breast cancer. International Journal Of Oncology. 2019;54(3):833-844. 

Sun, Lichao; Guo, Chunguang; Yuan, Hebao; Burnett, Joseph; Pan, Jian; Yang, Zhihua; Ran, Yuliang; Myers, Ila; Sun, Duxin. Overexpression of carboxypeptidase A4 (CPA4) is associated with poor prognosis in patients with gastric cancer. American Journal Of Translational Research. 8(11):5071-5075. 

Sun, Lichao; Guo, Chunguang; Burnett, Joseph; Pan, Jian; Yang, Zhihua; Ran, Yuliang; Sun, Duxin. Association between expression of Carboxypeptidase 4 and stem cell markers and their clinical significance in liver cancer development. Journal Of Cancer. 8(1):111-116. 

Wang, Yipeng; Xie, Yibin; Niu, Yanan; Song, Peng; Liu, Ye; Burnett, Joseph; Yang, Zhihua; Sun, Duxin; Ran, Yuliang; Li, Yang; Sun, Lichao. Carboxypeptidase A4 negatively correlates with p53 expression and regulates the stemness of breast cancer cells. International Journal Of Medical Sciences. 18(8):1753-1759.