Anti CPA3 pAb (ATL-HPA008689 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008689-25

Protein Description: carboxypeptidase A3 (mast cell)
Gene Name: CPA3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001865: 82%, ENSRNOG00000011181: 82%
Entrez Gene ID: 1359
Uniprot ID: P15088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSL
• Gene Sequence: KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSL
• Gene ID - Mouse: ENSMUSG00000001865
• Gene ID - Rat: ENSRNOG00000011181
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CPA3 pAb (ATL-HPA008689 w/enhanced validation) – 4 Found

Kuo, Chih-Hsi Scott; Liu, Chien-Ying; Pavlidis, Stelios; Lo, Yu-Lun; Wang, Yen-Wen; Chen, Chih-Hung; Ko, How-Wen; Chung, Fu-Tsai; Lin, Tin-Yu; Wang, Tsai-Yu; Lee, Kang-Yun; Guo, Yi-Ke; Wang, Tzu-Hao; Yang, Cheng-Ta. Unique Immune Gene Expression Patterns in Bronchoalveolar Lavage and Tumor Adjacent Non-Neoplastic Lung Tissue in Non-Small Cell Lung Cancer. Frontiers In Immunology. 9( 29483918):232. 

Hämäläinen, Sanna; Kareinen, Lauri; Sukura, Antti; Kareinen, Ilona. Carboxypeptidase A3 expression in canine mast cell tumors and tissue-resident mast cells. Veterinary Pathology. 2022;59(2):236-243. 

Takabayashi, Tetsuji; Kato, Atsushi; Peters, Anju T; Suh, Lydia A; Carter, Roderick; Norton, James; Grammer, Leslie C; Tan, Bruce K; Chandra, Rakesh K; Conley, David B; Kern, Robert C; Fujieda, Shigeharu; Schleimer, Robert P. Glandular mast cells with distinct phenotype are highly elevated in chronic rhinosinusitis with nasal polyps. The Journal Of Allergy And Clinical Immunology. 2012;130(2):410-20.e5. 

Siddhuraj, Premkumar; Clausson, Carl-Magnus; Sanden, Caroline; Alyamani, Manar; Kadivar, Mohammad; Marsal, Jan; Wallengren, Joanna; Bjermer, Leif; Erjefält, Jonas S. Lung Mast Cells Have a High Constitutive Expression of Carboxypeptidase A3 mRNA That Is Independent from Granule-Stored CPA3. Cells. 2021;10(2)