Anti CPA2 pAb (ATL-HPA021317 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021317-25
  • Immunohistochemistry analysis in human pancreas and liver tissues using HPA021317 antibody. Corresponding CPA2 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: carboxypeptidase A2 (pancreatic)
Gene Name: CPA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071553: 75%, ENSRNOG00000028092: 82%
Entrez Gene ID: 1358
Uniprot ID: P48052
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFVNVQAVKVFLESQGIAYSI
Gene Sequence LETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFVNVQAVKVFLESQGIAYSI
Gene ID - Mouse ENSMUSG00000071553
Gene ID - Rat ENSRNOG00000028092
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CPA2 pAb (ATL-HPA021317 w/enhanced validation)
Datasheet Anti CPA2 pAb (ATL-HPA021317 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPA2 pAb (ATL-HPA021317 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CPA2 pAb (ATL-HPA021317 w/enhanced validation)
Datasheet Anti CPA2 pAb (ATL-HPA021317 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CPA2 pAb (ATL-HPA021317 w/enhanced validation)