Anti CP pAb (ATL-HPA001834)

Atlas Antibodies

Catalog No.:
ATL-HPA001834-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ceruloplasmin (ferroxidase)
Gene Name: CP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003617: 83%, ENSRNOG00000011913: 83%
Entrez Gene ID: 1356
Uniprot ID: P00450
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGI
Gene Sequence YFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGI
Gene ID - Mouse ENSMUSG00000003617
Gene ID - Rat ENSRNOG00000011913
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CP pAb (ATL-HPA001834)
Datasheet Anti CP pAb (ATL-HPA001834) Datasheet (External Link)
Vendor Page Anti CP pAb (ATL-HPA001834) at Atlas Antibodies

Documents & Links for Anti CP pAb (ATL-HPA001834)
Datasheet Anti CP pAb (ATL-HPA001834) Datasheet (External Link)
Vendor Page Anti CP pAb (ATL-HPA001834)
Citations for Anti CP pAb (ATL-HPA001834) – 3 Found
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Hametner, Simon; Wimmer, Isabella; Haider, Lukas; Pfeifenbring, Sabine; Brück, Wolfgang; Lassmann, Hans. Iron and neurodegeneration in the multiple sclerosis brain. Annals Of Neurology. 2013;74(6):848-61.  PubMed
Kaleri, Najeeb Ahmed; Sun, Kang; Wang, Le; Li, Jin; Zhang, Wenzheng; Chen, Xuan; Li, Xinghui. Dietary Copper Reduces the Hepatotoxicity of (-)-Epigallocatechin-3-Gallate in Mice. Molecules (Basel, Switzerland). 2017;23(1)  PubMed