Anti CP pAb (ATL-HPA001834)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001834-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003617: 83%, ENSRNOG00000011913: 83%
Entrez Gene ID: 1356
Uniprot ID: P00450
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGI |
| Gene Sequence | YFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGI |
| Gene ID - Mouse | ENSMUSG00000003617 |
| Gene ID - Rat | ENSRNOG00000011913 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CP pAb (ATL-HPA001834) | |
| Datasheet | Anti CP pAb (ATL-HPA001834) Datasheet (External Link) |
| Vendor Page | Anti CP pAb (ATL-HPA001834) at Atlas Antibodies |
| Documents & Links for Anti CP pAb (ATL-HPA001834) | |
| Datasheet | Anti CP pAb (ATL-HPA001834) Datasheet (External Link) |
| Vendor Page | Anti CP pAb (ATL-HPA001834) |
| Citations for Anti CP pAb (ATL-HPA001834) – 3 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Hametner, Simon; Wimmer, Isabella; Haider, Lukas; Pfeifenbring, Sabine; Brück, Wolfgang; Lassmann, Hans. Iron and neurodegeneration in the multiple sclerosis brain. Annals Of Neurology. 2013;74(6):848-61. PubMed |
| Kaleri, Najeeb Ahmed; Sun, Kang; Wang, Le; Li, Jin; Zhang, Wenzheng; Chen, Xuan; Li, Xinghui. Dietary Copper Reduces the Hepatotoxicity of (-)-Epigallocatechin-3-Gallate in Mice. Molecules (Basel, Switzerland). 2017;23(1) PubMed |