Anti COX7A2L pAb (ATL-HPA059124)

Atlas Antibodies

Catalog No.:
ATL-HPA059124-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cytochrome c oxidase subunit VIIa polypeptide 2 like
Gene Name: COX7A2L
Alternative Gene Name: COX7AR, COX7RP, EB1, SIG81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024248: 85%, ENSRNOG00000004526: 58%
Entrez Gene ID: 9167
Uniprot ID: O14548
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY
Gene Sequence YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY
Gene ID - Mouse ENSMUSG00000024248
Gene ID - Rat ENSRNOG00000004526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COX7A2L pAb (ATL-HPA059124)
Datasheet Anti COX7A2L pAb (ATL-HPA059124) Datasheet (External Link)
Vendor Page Anti COX7A2L pAb (ATL-HPA059124) at Atlas Antibodies

Documents & Links for Anti COX7A2L pAb (ATL-HPA059124)
Datasheet Anti COX7A2L pAb (ATL-HPA059124) Datasheet (External Link)
Vendor Page Anti COX7A2L pAb (ATL-HPA059124)