Anti COX18 pAb (ATL-HPA049489)

Atlas Antibodies

Catalog No.:
ATL-HPA049489-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: COX18 cytochrome C oxidase assembly factor
Gene Name: COX18
Alternative Gene Name: FLJ38991
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035505: 89%, ENSRNOG00000003052: 86%
Entrez Gene ID: 285521
Uniprot ID: Q8N8Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYQHYILAKVENLQPEIKTIARHLNQEVAVRANQLGWSKRDARLTYLKNMRRLISELYVRDNC
Gene Sequence AYQHYILAKVENLQPEIKTIARHLNQEVAVRANQLGWSKRDARLTYLKNMRRLISELYVRDNC
Gene ID - Mouse ENSMUSG00000035505
Gene ID - Rat ENSRNOG00000003052
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COX18 pAb (ATL-HPA049489)
Datasheet Anti COX18 pAb (ATL-HPA049489) Datasheet (External Link)
Vendor Page Anti COX18 pAb (ATL-HPA049489) at Atlas Antibodies

Documents & Links for Anti COX18 pAb (ATL-HPA049489)
Datasheet Anti COX18 pAb (ATL-HPA049489) Datasheet (External Link)
Vendor Page Anti COX18 pAb (ATL-HPA049489)