Anti COX16 pAb (ATL-HPA062659)

Atlas Antibodies

Catalog No.:
ATL-HPA062659-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)
Gene Name: COX16
Alternative Gene Name: C14orf112, HSPC203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021139: 83%, ENSRNOG00000047115: 83%
Entrez Gene ID: 51241
Uniprot ID: Q9P0S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT
Gene Sequence IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT
Gene ID - Mouse ENSMUSG00000021139
Gene ID - Rat ENSRNOG00000047115
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COX16 pAb (ATL-HPA062659)
Datasheet Anti COX16 pAb (ATL-HPA062659) Datasheet (External Link)
Vendor Page Anti COX16 pAb (ATL-HPA062659) at Atlas Antibodies

Documents & Links for Anti COX16 pAb (ATL-HPA062659)
Datasheet Anti COX16 pAb (ATL-HPA062659) Datasheet (External Link)
Vendor Page Anti COX16 pAb (ATL-HPA062659)