Anti COX16 pAb (ATL-HPA062659)

Atlas Antibodies

Catalog No.: ATL-HPA062659-25

Protein Description: COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)
Gene Name: COX16
Alternative Gene Name: C14orf112, HSPC203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021139: 83%, ENSRNOG00000047115: 83%
Entrez Gene ID: 51241
Uniprot ID: Q9P0S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT
• Gene Sequence: IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT
• Gene ID - Mouse: ENSMUSG00000021139
• Gene ID - Rat: ENSRNOG00000047115
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.