Anti COX15 pAb (ATL-HPA037728)

Atlas Antibodies

SKU:
ATL-HPA037728-25
  • Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cytochrome c oxidase assembly homolog 15 (yeast)
Gene Name: COX15
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040018: 64%, ENSRNOG00000017230: 63%
Entrez Gene ID: 1355
Uniprot ID: Q7KZN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGR
Gene Sequence MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGR
Gene ID - Mouse ENSMUSG00000040018
Gene ID - Rat ENSRNOG00000017230
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COX15 pAb (ATL-HPA037728)
Datasheet Anti COX15 pAb (ATL-HPA037728) Datasheet (External Link)
Vendor Page Anti COX15 pAb (ATL-HPA037728) at Atlas Antibodies

Documents & Links for Anti COX15 pAb (ATL-HPA037728)
Datasheet Anti COX15 pAb (ATL-HPA037728) Datasheet (External Link)
Vendor Page Anti COX15 pAb (ATL-HPA037728)